GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lacA in Sphingomonas koreensis DSMZ 15582

Align periplasmic glucoside 3-dehydrogenase (lacA subunit) (EC 1.1.99.13) (characterized)
to candidate Ga0059261_0546 Ga0059261_0546 Choline dehydrogenase and related flavoproteins

Query= reanno::Cola:Echvi_1847
         (559 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_0546 Ga0059261_0546 Choline
           dehydrogenase and related flavoproteins
          Length = 560

 Score =  498 bits (1282), Expect = e-145
 Identities = 262/560 (46%), Positives = 355/560 (63%), Gaps = 12/560 (2%)

Query: 2   ANQEYDAIVVGSGISGGWAAKELTEKGLKVLLLERGQNVEHVKDYKNATLPPWEIPHRGR 61
           +   +DAIV+GSG+SGG+AAKELTEKGL+VL+L+RG  VEH +DY     P +E+P R  
Sbjct: 3   STNRFDAIVIGSGVSGGFAAKELTEKGLRVLMLDRGVMVEHGEDYTYDGKPAYEVPARNI 62

Query: 62  RTTEMVENHPNLKRDYVLNELVLDWWAHEDTSPYVEEK--PFTWFRGYQVGGRSLLWGRQ 119
               ++E+   + ++  +      ++  +  +PY  ++   F W R   VGG+SL+WGR 
Sbjct: 63  MPKPLIESDYFIAKNGYVAPSNRRFYNDDRLNPYAHDEGSKFFWIRPGAVGGKSLIWGRW 122

Query: 120 SYRWSDLDFEANLKEGIAVDWPIRYKDIAPWYDYVEKFAGIAGNRDGLDVLPDGEFMPPF 179
           S+RWS  DFEAN +EGI  DWPIRY DIAPWY  VE + G++G+R+ L  LPD EF PP 
Sbjct: 123 SFRWSADDFEANKREGIDGDWPIRYDDIAPWYSKVENYIGVSGSRENLPQLPDSEFQPPM 182

Query: 180 AMNCVEKDVKERIAKHFEGKRHLINSRVANITEPLP--GRPGCQARNKCWLGCPFGGYFS 237
            MN  EK VK+R+   F G++ LIN+R++N+TE  P   R  CQ RN+C  GC FG YFS
Sbjct: 183 PMNIAEKWVKQRLETQFPGRK-LINARLSNLTEDKPEQNRTKCQMRNQCGNGCSFGAYFS 241

Query: 238 TQASTLPAAMATGNLTLRPYSIVHRVLYDKDTKKATGVEIVDAETMETIEYKSKIVFLCA 297
           TQA TLPAA ATG LTLR  ++V  + YD   K+ TGV  VDA T +     + +VFLCA
Sbjct: 242 TQAVTLPAARATGRLTLRSDAVVTNLEYDPVRKRVTGVRFVDARTRQAEVVNADLVFLCA 301

Query: 298 SALNSAHVLMRSATDIWPEGLGSSSGELGHNVMDHHFRLGASGTVEGYDDKYYFGRRPGG 357
           SA+ S  +LM S           SSG LG  VMDH FR+G  G + G  +   +GRRPGG
Sbjct: 302 SAMASTQILMNSRAAGSGRSHFDSSGTLGKYVMDHIFRVGIEGEIPGMSEYIEYGRRPGG 361

Query: 358 IYIPRYRNVG-DDKRDYVRGFGYQGGASRSGWGRDVAE-MNIGGPMKEALTEPGPWSMGM 415
           IYIPR+RN+G D+   + RG+GYQGGA R     DVA  +  G  MK  + +  PW   +
Sbjct: 362 IYIPRFRNIGADENLGFKRGYGYQGGAHR-----DVAPPVGFGASMKHGMRKYAPWKFHI 416

Query: 416 MAFGEILPYHENTIKISKDVKDKWGMYALVMNAEIKDNEQKMRKDMMNDAAEMLEAAGVK 475
            AFGE LPY +N++ +  D  D++G+  +  +   ++NE +M  D       ML+AAG+ 
Sbjct: 417 SAFGECLPYRDNSVSLHADKVDRFGVPLMRFDVRFRENELRMMADARTQGEAMLKAAGLG 476

Query: 476 NIHTYDSGYTFGQGIHEMGTARMGRDPKTSVLNENNQVWDAKNVFVTDGAAMTSAAAVNP 535
           ++ +++  +  G  IHEMG ARMG DP++SVLN  +Q  DA N++VTDGA M S + VNP
Sbjct: 477 SVRSWEGEHVPGDAIHEMGGARMGADPRSSVLNSWSQAHDASNLYVTDGAQMASVSCVNP 536

Query: 536 SLTYMALTARAADFAVKELK 555
           SLT+MALT RAAD AV+ L+
Sbjct: 537 SLTFMALTVRAADHAVRTLR 556


Lambda     K      H
   0.317    0.135    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 857
Number of extensions: 36
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 559
Length of database: 560
Length adjustment: 36
Effective length of query: 523
Effective length of database: 524
Effective search space:   274052
Effective search space used:   274052
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory