Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate Ga0059261_3668 Ga0059261_3668 ABC transporter
Query= SwissProt::Q9YGA6 (372 letters) >FitnessBrowser__Korea:Ga0059261_3668 Length = 201 Score = 130 bits (326), Expect = 4e-35 Identities = 72/191 (37%), Positives = 112/191 (58%), Gaps = 8/191 (4%) Query: 21 EMSLEVKDGE-FMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVPPK 79 ++S ++ GE ++L GPSG GKT+ L M+AGL EP G + +G + + D G VPP+ Sbjct: 15 QISCRIEGGEGIIVLFGPSGVGKTSVLDMVAGLLEPDTGHVRVGGETLFDAAIGEDVPPE 74 Query: 80 DRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRE 139 R VFQ L+PH++V N+ + + ++A + LL+R PR Sbjct: 75 RRRAGYVFQDARLFPHLSVRANLLYGAG-------GDPSGLGDLAARFDIAHLLDRWPRS 127 Query: 140 LSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYVTHD 199 LSGG+ +RVA+GRA++ KP+ L+DEPLS+LD R + +++L+ + + + VTHD Sbjct: 128 LSGGEARRVAIGRALLAKPRFLLLDEPLSSLDRARREEVTRVIERLRDEAALPILMVTHD 187 Query: 200 QVEAMTMGDRI 210 VEA +G RI Sbjct: 188 PVEAERLGQRI 198 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 210 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 201 Length adjustment: 25 Effective length of query: 347 Effective length of database: 176 Effective search space: 61072 Effective search space used: 61072 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory