GapMind for catabolism of small carbon sources

 

Aligments for a candidate for treF in Sphingomonas koreensis DSMZ 15582

Align Putative alpha-glucosidase AglA (characterized, see rationale)
to candidate Ga0059261_1580 Ga0059261_1580 Glycosidases

Query= uniprot:I7EUW4
         (552 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_1580 Ga0059261_1580
           Glycosidases
          Length = 541

 Score =  528 bits (1359), Expect = e-154
 Identities = 258/506 (50%), Positives = 327/506 (64%), Gaps = 11/506 (2%)

Query: 9   PAQVLAADPDWWRGAVIYQIYPRSYQDSNGDGIGDLRGITQRLPHIASLGVDAIWISPFF 68
           P      + DWWRGAVIYQIYPRS+ DSNGDGIGDL G+   L H+A+LG DAIW+SPFF
Sbjct: 6   PMPATETNRDWWRGAVIYQIYPRSFADSNGDGIGDLPGVAAHLDHVAALGADAIWLSPFF 65

Query: 69  TSPMKDFGYDVSDYCDVDPMFGSLSNFDQLVAAAHRLGLRVMIDLVLSHTSDQHAWFGES 128
           TSPM+DFGYD++DYC VDP+FG+L++FD ++  AH LGL+V+ID V SHTSDQH WF ES
Sbjct: 66  TSPMRDFGYDIADYCGVDPVFGTLADFDAVIEKAHALGLKVIIDQVYSHTSDQHEWFKES 125

Query: 129 RQSRDNARADWYVWADPQPDGTPPNNWLSIFGGSAWQWDPRREQYYLHNFLVSQPDLNFH 188
           R SRDNA+ADWYVWAD + DG+PP NW S+FGG AW WD RR QYYLHNFL  QPDLN H
Sbjct: 126 RSSRDNAKADWYVWADAKADGSPPTNWQSVFGGPAWTWDARRGQYYLHNFLSEQPDLNLH 185

Query: 189 SPAVQDALLDVTRFWLERGVDGFRLDTINFYYHDAELRSNPALPPEQRNATIAPSVNPYN 248
           +P VQ+A L   RFWL+RGVDGFR+D INF  HD E R NP  P      T  P   P++
Sbjct: 186 NPQVQNAALAAARFWLDRGVDGFRVDAINFAMHDPEFRDNPPAP-----YTGTPRTRPFD 240

Query: 249 HQEHLYSKNQPENLAFLGRFRALLDEYPAKAAVGEVGDAQRGLEIMGSYTAANTGVHMCY 308
            Q+HLY+++ P+ + FL R R L D Y  +  V EVG      E M ++T     ++  Y
Sbjct: 241 FQQHLYNQSHPDIVRFLERHRELTDSYGGRFTVAEVGGPTPEAE-MHAFTQGQKRLNSAY 299

Query: 309 AFELLAKDVLTASRLAEVFAEVDRVAANGWACWAFSNHDVIRHSSRWGLNPAAQRLFTTM 368
            F+ L  + LT + + +           GW  WAF NHD  R  SRW ++   +  F  M
Sbjct: 300 GFDFLYANKLTPALVKKAVETWPDTHGTGWPSWAFENHDAPRALSRW-VDAEHRDAFAAM 358

Query: 369 ----MMCLRGTTCIYQGEELGLPEADIAFEDLQDPYGIEFWPEFKGRDGCRTPMVWEPSN 424
               +MCLRG   ++QGEELGL + +IA++ LQDP  I  WP    RDG RTPM W+   
Sbjct: 359 KMLLLMCLRGNAILFQGEELGLTQVEIAYDQLQDPEAIANWPLTLSRDGVRTPMPWKADA 418

Query: 425 GSGGFSAGKPWLPVSPEHLNLSVASQEADPDAMLHHYRRAIALRKAHPALAVGTHDQLRA 484
            + GF+AG+PWLP+ P+H  L+V  Q A   ++L+  R  IALR A+PAL  G  + L A
Sbjct: 419 ENLGFTAGRPWLPLGPDHGALAVDRQIAQNGSLLNLTRGLIALRAANPALRAGAMEVLAA 478

Query: 485 EGNVAFFTRQDRDEVIFCAFNLGDIP 510
           +  +  FTR    + + CAFNLG  P
Sbjct: 479 DEALLVFTRIADGQALTCAFNLGKTP 504


Lambda     K      H
   0.321    0.137    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1039
Number of extensions: 53
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 552
Length of database: 541
Length adjustment: 36
Effective length of query: 516
Effective length of database: 505
Effective search space:   260580
Effective search space used:   260580
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory