Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate Ga0059261_3276 Ga0059261_3276 ABC-type multidrug transport system, ATPase and permease components
Query= uniprot:P40735 (281 letters) >FitnessBrowser__Korea:Ga0059261_3276 Length = 595 Score = 108 bits (270), Expect = 3e-28 Identities = 82/235 (34%), Positives = 116/235 (49%), Gaps = 23/235 (9%) Query: 7 ISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDI 66 I +++ FRY E AL +L V GE +A+VG +G+GKSTL + + PE G+I Sbjct: 353 IDFKNVTFRYPTRPEVSALHQFTLSVAPGETVAVVGPSGAGKSTLFQLVQRFYDPEGGEI 412 Query: 67 EVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDW- 125 V GI + EVR ++ MV Q + T RD++ +G R + E W Sbjct: 413 RVDGIPVRSADPGEVRARMAMVPQ--ETVIFAATARDNLRYG-------RWDATEEQIWQ 463 Query: 126 AVKQVNMQDFLDQEPH-----------HLSGGQKQRVAIAGVIAARPDIIILDEATSMLD 174 A + N +FL + P LSGGQ+QR+AIA + I++LDEATS LD Sbjct: 464 AAEAANAAEFLRELPQGLETFLGEDGARLSGGQRQRLAIARALLRDAPILLLDEATSALD 523 Query: 175 PIGREEVLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYAEGPPEEI 229 V + + HL QG T++ I H L A RIIVM+ G+ G E+ Sbjct: 524 AESERLVQDALEHLM-QGRTTLV-IAHRLATVRAAKRIIVMDEGRIVETGTHAEL 576 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 595 Length adjustment: 31 Effective length of query: 250 Effective length of database: 564 Effective search space: 141000 Effective search space used: 141000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory