Align Tryptophan 2,3-dioxygenase (EC 1.13.11.11) (characterized)
to candidate Ga0059261_1376 Ga0059261_1376 Tryptophan 2,3-dioxygenase (vermilion)
Query= reanno::Cup4G11:RR42_RS15390 (291 letters) >FitnessBrowser__Korea:Ga0059261_1376 Length = 254 Score = 265 bits (676), Expect = 1e-75 Identities = 133/258 (51%), Positives = 169/258 (65%), Gaps = 9/258 (3%) Query: 32 DMSYGDYLALDQILNAQHPLSPEHNEMLFIVQHQTSELWMKLALHELRAARECVRQDQLP 91 DM+YG YLALDQ+L+AQHP+S EH+E+LF++ HQT ELW+K A+ ELR A + VR D+L Sbjct: 4 DMTYGRYLALDQLLSAQHPISDEHDELLFVIIHQTKELWLKQAIAELRVALDLVRNDKLV 63 Query: 92 PAFKMLTRVSRIMEQLVQAWNVLATMTPPEYSAMRPYLGMSSGFQSFQYREIEFILGNKN 151 A+K L RVSRI + +W VL TMTP +YSA R LG SSGFQS Q+R +E +LG + Sbjct: 64 EAYKSLARVSRIQAVMTLSWEVLTTMTPSDYSAFRSVLGGSSGFQSDQFRAVETLLGLRG 123 Query: 152 AAMLRPHAHQPQHLALLEEALRTPSLYDEAIRLMARRGFAIDAACIERDWTRPAGENASV 211 + P L E PSL+DEA +AR F + + RDW++P + V Sbjct: 124 GGVPGP---------LTTEFAALPSLWDEANAALARADFDLPETALNRDWSKPYQPSPEV 174 Query: 212 EAAWLEVYRKPEAHWELYELGEKFVDLEDAFRQWRFRHVTTVERVIGFKRGTGGTEGVSY 271 EAAW++VYR P WELY+L EK VD++DA WR +HV TV RVIG K GTGGT GV Y Sbjct: 175 EAAWVQVYRDPHRWWELYQLAEKLVDIDDALATWRHKHVLTVSRVIGMKPGTGGTPGVPY 234 Query: 272 LRKMLDVVLFPELWKLRT 289 L+ + FPELW LRT Sbjct: 235 LQSTVAKRAFPELWSLRT 252 Lambda K H 0.322 0.134 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 254 Length adjustment: 25 Effective length of query: 266 Effective length of database: 229 Effective search space: 60914 Effective search space used: 60914 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory