Align 3-oxoadipate CoA-transferase subunit A; EC 2.8.3.6 (characterized)
to candidate Ga0059261_0265 Ga0059261_0265 3-oxoacid CoA-transferase, A subunit
Query= CharProtDB::CH_021928 (231 letters) >FitnessBrowser__Korea:Ga0059261_0265 Length = 235 Score = 200 bits (509), Expect = 2e-56 Identities = 105/217 (48%), Positives = 143/217 (65%), Gaps = 3/217 (1%) Query: 2 INKTYESIASAVEGIT-DGSTIMVGGFGTAGMPSELIDGLIATGARDLTIISNNAGNGEI 60 + K Y S +A+EG+ DG TI GGFG G+P LID + A+G RD+TI SNNAG Sbjct: 1 MKKLYPSAEAALEGLLHDGITICAGGFGLCGIPERLIDAIQASGVRDMTIASNNAGIDNE 60 Query: 61 GLAALLMAGSVRKVVCSFPRQSDSYVFDELYRAGKIELEVVPQGNLAERIAAAGSGIGAF 120 GL LL + VRK++ S+ ++ F+ Y AG++E+E PQG LAER A G+GI F Sbjct: 61 GLGKLLRSRQVRKMISSYVGENKE--FERQYLAGELEVEFCPQGTLAERCRAGGAGIPGF 118 Query: 121 FSPTGYGTLLAEGKETREIDGRMYVLEMPLHADFALIKAHKGDRWGNLTYRKAARNFGPI 180 ++ TG GT +AEGKET+ DG+ Y+LE + AD A+IK K D GNL +RK ARNF Sbjct: 119 YTKTGVGTKVAEGKETKVFDGQEYILERGIRADLAIIKGWKADEAGNLIFRKTARNFNQP 178 Query: 181 MAMAAKTAIAQVDQVVELGELDPEHIITPGIFVQRVV 217 MA AA +A+V++VV +G LDP+ I PGI+V+R++ Sbjct: 179 MATAANICVAEVEEVVPVGSLDPDAIHLPGIYVKRMI 215 Lambda K H 0.318 0.135 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 231 Length of database: 235 Length adjustment: 23 Effective length of query: 208 Effective length of database: 212 Effective search space: 44096 Effective search space used: 44096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory