Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate Ga0059261_2015 Ga0059261_2015 maleylacetoacetate isomerase
Query= reanno::MR1:200836 (216 letters) >FitnessBrowser__Korea:Ga0059261_2015 Length = 208 Score = 202 bits (514), Expect = 4e-57 Identities = 110/211 (52%), Positives = 140/211 (66%), Gaps = 7/211 (3%) Query: 1 MILYGYWRSSAAYRVRIALNLKGVSAEQLSVHLVRDGGEQHKADYIALNPQELVPTLVVD 60 MILY Y+RSSAAYRVRIALNLKGV AE+ VHLV+ GEQ +++A NPQ VP L Sbjct: 1 MILYDYFRSSAAYRVRIALNLKGVEAERREVHLVK--GEQRSPEHVARNPQGFVPAL--- 55 Query: 61 DEQDGDALTQSLAIIEYLDELYPKTPLLPASALERAHVRAMALTIACEIHPLNNLRVLQY 120 D +G LTQSLAIIE+LD +YP+ L+PA L RA A ALTIA + HP+NNLR+L+ Sbjct: 56 DIGNGHILTQSLAIIEWLDSVYPEPRLIPADPLARADAMARALTIAADTHPVNNLRILKR 115 Query: 121 LTQKLTVNEEAKSAWYHHWVATGFTALETQLVRHSGRYCFGDKVTIADLCLVPQVYNAQR 180 L + +E AK WY HW+A GF ALE + SG + G ++D+ LVPQ+YNA+R Sbjct: 116 LETQFGADEAAKGEWYRHWIAEGFAALEA--MAGSGPFLGGGAPDVSDVLLVPQMYNARR 173 Query: 181 FNVDLTPYPNIMRVWAECNQLPAFADAAPER 211 F + L PYP ++ A + L FA A P+R Sbjct: 174 FELPLDPYPRLVAADAAASALAPFAAAHPDR 204 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 208 Length adjustment: 21 Effective length of query: 195 Effective length of database: 187 Effective search space: 36465 Effective search space used: 36465 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate Ga0059261_2015 Ga0059261_2015 (maleylacetoacetate isomerase)
to HMM TIGR01262 (maiA: maleylacetoacetate isomerase (EC 5.2.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01262.hmm # target sequence database: /tmp/gapView.10489.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01262 [M=211] Accession: TIGR01262 Description: maiA: maleylacetoacetate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-76 243.2 0.0 1.2e-76 243.1 0.0 1.0 1 lcl|FitnessBrowser__Korea:Ga0059261_2015 Ga0059261_2015 maleylacetoacetat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Korea:Ga0059261_2015 Ga0059261_2015 maleylacetoacetate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 243.1 0.0 1.2e-76 1.2e-76 1 208 [. 2 206 .. 2 208 .] 0.98 Alignments for each domain: == domain 1 score: 243.1 bits; conditional E-value: 1.2e-76 TIGR01262 1 klYsyfrSsasyRvRiaLaLkgidyesvpvnLlkdGeqkkeefkalNPqelvPtLkidegevltqSlAi 69 +lY+yfrSsa+yRvRiaL+Lkg++ e + v+L+k Geq+++e+ a+NPq+ vP+L+i++g++ltqSlAi lcl|FitnessBrowser__Korea:Ga0059261_2015 2 ILYDYFRSSAAYRVRIALNLKGVEAERREVHLVK-GEQRSPEHVARNPQGFVPALDIGNGHILTQSLAI 69 59********************************.9********************************* PP TIGR01262 70 ieyLeetypepaLlpkdpakrarvralalliacdihPlqNlrvlqlleeklgvdeeekkewlkhwiekG 138 ie+L+ ypep+L+p+dp +ra + a al+ia+d hP++Nlr+l++le+++g+de++k ew++hwi++G lcl|FitnessBrowser__Korea:Ga0059261_2015 70 IEWLDSVYPEPRLIPADPLARADAMARALTIAADTHPVNNLRILKRLETQFGADEAAKGEWYRHWIAEG 138 ********************************************************************* PP TIGR01262 139 laalEellkekagafcvGdevtladvcLvpqvynAerfevdlaqyPtlkrieealaelpafqeahpenq 207 +aalE++ + g f G ++ + dv+Lvpq+ynA+rfe+ l++yP+l + ++a+++l f++ahp+++ lcl|FitnessBrowser__Korea:Ga0059261_2015 139 FAALEAMAGS--GPFLGGGAPDVSDVLLVPQMYNARRFELPLDPYPRLVAADAAASALAPFAAAHPDRA 205 ******9876..******************************************************998 PP TIGR01262 208 p 208 + lcl|FitnessBrowser__Korea:Ga0059261_2015 206 K 206 6 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (208 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.96 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory