Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate Ga0059261_2668 Ga0059261_2668 Enoyl-CoA hydratase/carnithine racemase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2986 (356 letters) >FitnessBrowser__Korea:Ga0059261_2668 Length = 256 Score = 99.8 bits (247), Expect = 7e-26 Identities = 64/183 (34%), Positives = 96/183 (52%), Gaps = 13/183 (7%) Query: 4 MQNEVLAEVRNHIGHLTLNRPAGLNALTLDMVRNLHRQLDAWAQDSQVHAVVLRGAGEKA 63 M +++L V +H+ +TLNRPA LNALT +M L + A V VV+ GAGEKA Sbjct: 1 MTDDLLFTVADHVATITLNRPAKLNALTPEMAAALIASVSACNSSDAVRCVVITGAGEKA 60 Query: 64 FCAGGDIRSLHDSFKSGDTLHEDFFVEEYALDLAIHHYRKPVLALMDGFVLGGGMGLVQG 123 F AG DI +L D + D + + A+ RKPV+A ++G+ LGGG+ Sbjct: 61 FSAGSDITTLDGYATPWDFRNRDDYCD------ALRACRKPVVAAINGYALGGGLETAMA 114 Query: 124 ADLRVVTEKSRLAMPEVGIGYFPDVGGSYFLSRIPGELG----IYLGVSGVQIRAADALY 179 AD+R+ + +R A PE+ +G+ +GG + + +G + +G I A AL Sbjct: 115 ADIRIASTNARFAAPEIKLGW---IGGGGMAAGLTYSMGASNAALMLFTGDMIDAEKALA 171 Query: 180 CGL 182 GL Sbjct: 172 WGL 174 Lambda K H 0.322 0.139 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 256 Length adjustment: 27 Effective length of query: 329 Effective length of database: 229 Effective search space: 75341 Effective search space used: 75341 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory