Align crotonase (EC 4.2.1.150) (characterized)
to candidate Ga0059261_2668 Ga0059261_2668 Enoyl-CoA hydratase/carnithine racemase
Query= metacyc::MONOMER-13469 (259 letters) >FitnessBrowser__Korea:Ga0059261_2668 Length = 256 Score = 161 bits (408), Expect = 1e-44 Identities = 100/249 (40%), Positives = 139/249 (55%), Gaps = 6/249 (2%) Query: 13 NVASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSG-KAFVAGADIAEMK 71 +VA+ITLNRP LNAL + A+++ D V V+ITG+G KAF AG+DI + Sbjct: 12 HVATITLNRPAKLNALTPEMAAALIASVSACNSSDAVRCVVITGAGEKAFSAGSDITTLD 71 Query: 72 DL-TAVEGRKFSVLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCDIRIASSKAKFG 130 T + R + L KPV+AAING+ALGGG E +++ DIRIAS+ A+F Sbjct: 72 GYATPWDFRN----RDDYCDALRACRKPVVAAINGYALGGGLETAMAADIRIASTNARFA 127 Query: 131 QPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVNKVVEPDKLLEE 190 PE+ LG G G L ++G A +++TG +I+AE+AL GLV++VV PD LL Sbjct: 128 APEIKLGWIGGGGMAAGLTYSMGASNAALMLFTGDMIDAEKALAWGLVSEVVAPDALLAR 187 Query: 191 AKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAEVFGECFATEDRVEGMTAFVE 250 A+ + I APIA K + D + YE ++ CFAT+D EG AF E Sbjct: 188 AQEIARTIASRAPIAAETAKLNLRAAHTMPWDKAIEYERDLQAICFATDDAKEGRAAFAE 247 Query: 251 KRDKAFKNK 259 KR F+ + Sbjct: 248 KRAPVFRRR 256 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 256 Length adjustment: 24 Effective length of query: 235 Effective length of database: 232 Effective search space: 54520 Effective search space used: 54520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory