Align 3-hydroxyisobutyrate dehydrogenase; HIBADH; EC 1.1.1.31 (characterized)
to candidate Ga0059261_2836 Ga0059261_2836 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases
Query= SwissProt::P28811 (298 letters) >FitnessBrowser__Korea:Ga0059261_2836 Length = 290 Score = 121 bits (304), Expect = 2e-32 Identities = 75/215 (34%), Positives = 114/215 (53%), Gaps = 1/215 (0%) Query: 4 IAFLGLGNMGGPMAANLLKAGHRVNVFDLQPKAVLGLVEQGAQGADSALQCCEGAEVVIS 63 + F+GLG+ GGPMA ++ AG V ++ + A+ V +GA A E+V Sbjct: 3 VGFIGLGDQGGPMARMIVDAGFPVTLWARRASAIERFVARGAGVAADPAALASACELVCL 62 Query: 64 MLPAGQHVESLYLGDDGLLARVAGKPLLIDCSTIAPETARKVAEAAAAKGLTLLDAPVSG 123 + V L + D G++A + + L+ STI P+T ++A +A+G TLLD PVSG Sbjct: 63 CVTGDADVRELLI-DRGMIAALRKRSLVAIHSTINPKTCVELARMVSARGATLLDMPVSG 121 Query: 124 GVGGARAGTLSFIVGGPAEGFARARPVLENMGRNIFHAGDHGAGQVAKICNNMLLGILMA 183 A A L + GG A AR PVLE+ I GD GA AK+ NN++ + + Sbjct: 122 SGHAALARKLLVMTGGDAGAIARTMPVLESYAGTIIRMGDVGAAMNAKLVNNLMAVVNIG 181 Query: 184 GTAEALALGVKNGLDPAVLSEVMKQSSGGNWALNL 218 ALALG K G++PA L + + +G ++A++L Sbjct: 182 QAFHALALGRKVGVEPAALRQALMVGTGRSFAIDL 216 Lambda K H 0.317 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 290 Length adjustment: 26 Effective length of query: 272 Effective length of database: 264 Effective search space: 71808 Effective search space used: 71808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory