Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate Ga0059261_0292 Ga0059261_0292 acetyl-CoA carboxylase, biotin carboxylase subunit
Query= metacyc::MONOMER-13597 (509 letters) >FitnessBrowser__Korea:Ga0059261_0292 Length = 454 Score = 406 bits (1043), Expect = e-118 Identities = 219/450 (48%), Positives = 300/450 (66%), Gaps = 7/450 (1%) Query: 1 MPPFSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALD 60 +P ++L+ANRGEIA R+ +A EMG+ +AV+S AD A+H + AD+A IG A D Sbjct: 1 LPEIKKLLIANRGEIALRIHRACHEMGIKTVAVHSTADADAMHVRLADQAVCIGPPAAAD 60 Query: 61 SYLNIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLD 120 SYLNI +II AAE + DAIHPGYGFLSENA+FAE VE + F+GP E +R + DK++ Sbjct: 61 SYLNIPNIISAAEISGADAIHPGYGFLSENAKFAEIVELHNLIFVGPKPEHIRVMGDKVE 120 Query: 121 GKRLANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLM 180 KR A G+P PGSDG ++ ++EA KLA +IGYP+++KAASGGGG G+ + DQ Sbjct: 121 AKRTAGALGLPLVPGSDGAISDVEEAKKLAAEIGYPVIIKAASGGGGRGMKVCTDPDQFE 180 Query: 181 DVWERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKL 240 + ++ A AFG A +++EKY NPRHIE Q+ GD GN + ER+C++QRR+QK+ Sbjct: 181 TLMQQAGSEAKAAFGDATVYLEKYLGNPRHIEIQVFGDGNGNAIHLGERDCSLQRRHQKV 240 Query: 241 IEEAPSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEH 300 +EEAPSP L EER + E K + Y GT E F + +FYF+E+N RLQVEH Sbjct: 241 LEEAPSPVLSTEERNRIGEICAKAMADMGYRGAGTIE--FLWENGEFYFIEMNTRLQVEH 298 Query: 301 PTTELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFV 360 P TE I +DLV+ QI++A G L QED+ + RG AIE RINAED F S G V Sbjct: 299 PVTEAITGLDLVREQIRVAEGHGLTLRQEDV--QFRGHAIECRINAEDP-RTFAPSPGRV 355 Query: 361 TYYREPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKI--G 418 + Y P G VRVDSG+ SG VPPYYDS+++KLIVYG +R+ A++ RAL ++ I Sbjct: 356 SQYHAPGGMNVRVDSGLYSGYKVPPYYDSMIAKLIVYGTTRQGALRRLRRALEEFVIEGD 415 Query: 419 GIKTTIELYKWIMQDPDFQEGKFSTSYISQ 448 G+KTTI L++ ++ +P FQ+G ++ ++ + Sbjct: 416 GMKTTIPLHQALLDNPQFQQGDYTIKWLEE 445 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 454 Length adjustment: 34 Effective length of query: 475 Effective length of database: 420 Effective search space: 199500 Effective search space used: 199500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory