Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate Ga0059261_3874 Ga0059261_3874 ABC-type antimicrobial peptide transport system, ATPase component
Query= reanno::Dino:3607124 (338 letters) >FitnessBrowser__Korea:Ga0059261_3874 Length = 243 Score = 116 bits (291), Expect = 5e-31 Identities = 72/221 (32%), Positives = 114/221 (51%), Gaps = 11/221 (4%) Query: 2 AGIKIDKINKFYGT----TQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSS 57 A I +++K Y TQ LF +++ + GE + VGPSGCGKSTLL L+GL Sbjct: 7 AAIDAREVSKSYTVGQVRTQILFGVSVSVMPGELTLVVGPSGCGKSTLLAILSGLTLPDQ 66 Query: 58 GRIEIGGRDVTTVEPADRDL------AMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRK 111 G ++ G + ++ RD VFQ + L+ +T E + + ++ +P + Sbjct: 67 GEVDALGNPICRMKAGARDAFRLANTGFVFQGFNLFNALTAEEQVAYVLQCMKVKPAEAR 126 Query: 112 ERIAEAARVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQ 171 +R A + L + +P +LSGG++QRVAI RA+ K P + DEP S LD+ Sbjct: 127 QRARAALEAVGLGPRMRLRPFELSGGEKQRVAIARALAKQPRILFADEPTSALDSHNGHA 186 Query: 172 MRVELEGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRI 212 + L + GA ++ VTHD ++ AD+I+ + GRI Sbjct: 187 VIALLRDIAHNQGAAVLCVTHDP-RLLSFADRIIHMEDGRI 226 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 243 Length adjustment: 26 Effective length of query: 312 Effective length of database: 217 Effective search space: 67704 Effective search space used: 67704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory