Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate Ga0059261_2293 Ga0059261_2293 cell division ATP-binding protein FtsE
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Korea:Ga0059261_2293 Length = 235 Score = 123 bits (309), Expect = 5e-33 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 10/220 (4%) Query: 13 YAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLP 72 Y G L + + G F + G SG GK+++LR++ + + G +R+ G LP Sbjct: 14 YGTGAETLSDVSFTLSAGSFYFVTGASGAGKTSLLRLLYLAQRPTRGIVRLFGEDAGALP 73 Query: 73 ARE-----RNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEAL 127 + R + +VFQ++ L PH+S YDN+A LR P A+I+ VRE+ A + L+ Sbjct: 74 RKRLPGFRRRIGVVFQDFRLLPHLSAYDNVALPLRVAGIPEADIEGPVREMIAWVGLKDR 133 Query: 128 LERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTT 187 KP +SGG+QQR AIARA+I P + + DEP N+D + +L L+ RL TT Sbjct: 134 DSAKPPTLSGGEQQRIAIARAVITRPEILIADEPTGNVDPDMAERLLHLFDSLN-RLGTT 192 Query: 188 TVYVTHD-QLEAMTLADRVILMQDGRIVQAGSPAELYRYP 226 V THD QL + R++ ++ GR+ P RYP Sbjct: 193 VVVATHDFQLISRIPDARMMRIEKGRL---NDPTGALRYP 229 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 235 Length adjustment: 27 Effective length of query: 379 Effective length of database: 208 Effective search space: 78832 Effective search space used: 78832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory