Align SDR family oxidoreductase (characterized, see rationale)
to candidate Ga0059261_2675 Ga0059261_2675 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Korea:Ga0059261_2675 Length = 242 Score = 288 bits (738), Expect = 5e-83 Identities = 148/249 (59%), Positives = 187/249 (75%), Gaps = 8/249 (3%) Query: 6 GRLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLLDVTD 65 GRL GK L+TAA QGIGRA+ E F REGARVIATD+ E L + G ET LDVT Sbjct: 2 GRLEGKIALVTAAGQGIGRATVEAFVREGARVIATDV---RAEALDGLEGAETRQLDVTS 58 Query: 66 DDAIKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAVLPGML 125 DA+ A+ A+ ++VL+NCAG+V AG IL+CD+ AW+FS +LN A + IRAVLP M+ Sbjct: 59 KDAVAAIAAEFPELNVLYNCAGFVHAGTILDCDEDAWEFSQSLNVTAQYRMIRAVLPHMI 118 Query: 126 AKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNAICPGTIE 185 A+ GSI+N++S SS+K V NRFAYGA+KAAV+GLTKSVA D+V++GIRCNAICPGT+E Sbjct: 119 ARGGGSIINMSSVCSSIKAVPNRFAYGATKAAVIGLTKSVAIDYVTKGIRCNAICPGTVE 178 Query: 186 SPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDESNFTTGSI 245 +PSL QR+ +TG E + A F ARQ MGR G+ E+AALA+YLASDES FTTG++ Sbjct: 179 TPSLIQRL----HDTGDFE-KAYAEFTARQAMGRFGRTSELAALAVYLASDESAFTTGTV 233 Query: 246 HMIDGGWSN 254 ++IDGGW N Sbjct: 234 NVIDGGWVN 242 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 242 Length adjustment: 24 Effective length of query: 230 Effective length of database: 218 Effective search space: 50140 Effective search space used: 50140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory