Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate Ga0059261_1479 Ga0059261_1479 Lactate dehydrogenase and related dehydrogenases
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__Korea:Ga0059261_1479 Length = 332 Score = 263 bits (671), Expect = 6e-75 Identities = 140/323 (43%), Positives = 206/323 (63%), Gaps = 7/323 (2%) Query: 2 KPKVFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKEL 61 +P+V +TR++P+ + + ++ + +A R LL V + D LV VTD +D +L Sbjct: 9 RPRVAVTRELPDAIAARMGELFDTSFNQSDEAMDRAALLAAVADCDVLVPTVTDTIDADL 68 Query: 62 LENA-PKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV 120 + A +LK+IA + G ++ID++ A RGI VTNTPGVLT+ TAD+ AL+++V RR+ Sbjct: 69 IAAAGERLKLIANFGSGVNHIDLKAARARGIVVTNTPGVLTEDTADMTMALIVSVPRRLA 128 Query: 121 EADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYS 180 E + VRSG+WK GW P LG+ + GK LGIVG GRIGQA+A+RA+ FG+ I Y++ Sbjct: 129 EGEKLVRSGQWK----GWSPGGMLGHRIGGKKLGIVGMGRIGQAVARRARAFGLSIHYHN 184 Query: 181 RTRKPEA-EEEIGAEYV-DFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILIN 238 R R PE E E+GA + D + +L+E D +++H PL +E+ +I + + L+ P LIN Sbjct: 185 RHRLPEVVEAELGAAWHGDLDAMLREIDILTIHTPLNEESRDLIDARRIGLLGPQVYLIN 244 Query: 239 TSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEARE 298 SRG +VD A++ AL+ G +AGAGLDV+ EP + L L NVV+ PH+GSAT+E R Sbjct: 245 ASRGGIVDEEAMVDALEAGRLAGAGLDVWRFEPQIDPRLLALPNVVMTPHMGSATYEGRH 304 Query: 299 GMAELVAKNLIAFAKGEIPPNLV 321 E V N+ +A G PP+ V Sbjct: 305 ATGEKVIANIRFWADGHRPPDQV 327 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 266 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 332 Length adjustment: 28 Effective length of query: 303 Effective length of database: 304 Effective search space: 92112 Effective search space used: 92112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory