Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate Ga0059261_2264 Ga0059261_2264 D-3-phosphoglycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__Korea:Ga0059261_2264 Length = 525 Score = 192 bits (488), Expect = 2e-53 Identities = 107/286 (37%), Positives = 161/286 (56%), Gaps = 7/286 (2%) Query: 43 VREVDALVTLVTDKVDKELLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTD 102 + + D L KV KE+L+ A LK++ + +G DN+DI A+ +G+ V NTP + Sbjct: 40 IGQYDGLAIRSATKVTKEILDAATNLKVVGRAGIGVDNVDIPNASAKGVVVMNTPFGNSI 99 Query: 103 ATADLAFALLLAVARRIVEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIG 162 TA+ A AL+ A+AR++ EA+ ++G W K+ F+G + GKTLG++G G IG Sbjct: 100 TTAEHAIALMFALARQLPEANTQTQAGLWPKNG-------FMGVEVTGKTLGLIGAGNIG 152 Query: 163 QALAKRAKGFGMKIIYYSRTRKPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMI 222 +A RA G MK++ Y PE E+G E V+ E LL +DFI+LH PLT++T +++ Sbjct: 153 SIVADRAHGLRMKVVAYDPFLSPERAVEMGVEKVELEQLLARADFITLHTPLTEQTRNIL 212 Query: 223 GEKELKLMKPNAILINTSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKN 282 + L K +IN +RG ++D AL L G +AGA LDVF EP LF N Sbjct: 213 SAENLAKTKKGVRIINCARGGLIDEAALKDLLDSGHVAGAALDVFVTEPAKEHALFNTPN 272 Query: 283 VVLAPHIGSATHEAREGMAELVAKNLIAFAKGEIPPNLVNKDVLTS 328 V PH+G++T EA+ +A VA+ + + N +N LT+ Sbjct: 273 FVATPHLGASTSEAQVNVAIQVAEQMADYLVNGGVTNALNMPSLTA 318 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 525 Length adjustment: 31 Effective length of query: 300 Effective length of database: 494 Effective search space: 148200 Effective search space used: 148200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory