GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xad in Sphingomonas koreensis DSMZ 15582

Align Xylonate dehydratase (EC 4.2.1.82) (characterized)
to candidate Ga0059261_2649 Ga0059261_2649 Dihydroxyacid dehydratase/phosphogluconate dehydratase

Query= reanno::pseudo6_N2E2:Pf6N2E2_1668
         (594 letters)



>lcl|FitnessBrowser__Korea:Ga0059261_2649 Ga0059261_2649
           Dihydroxyacid dehydratase/phosphogluconate dehydratase
          Length = 618

 Score =  754 bits (1947), Expect = 0.0
 Identities = 370/595 (62%), Positives = 459/595 (77%), Gaps = 4/595 (0%)

Query: 4   TPKHRLRSEQWFNDPAHADMTALYVERYMNYGMTREELQSGRPIIGIAQTGSDLTPCNRH 63
           T + +LRS  WF++P + DMTALY+ERY+N+G++ +EL+SGRPIIGIAQTGSDL+PCNRH
Sbjct: 24  TEERKLRSAAWFDNPDNIDMTALYLERYLNFGLSLKELRSGRPIIGIAQTGSDLSPCNRH 83

Query: 64  HLELAQRVKAGIRDAGGIPMEFPVHPIAEQSRRPTAALDRNLAYLGLVEILHGYPLDGVV 123
           HL LA+RV+ GIRDAGGI +EFPVHPI E  +RPTA LDRNLAYLGLVE L+GYPLDGVV
Sbjct: 84  HLVLAERVREGIRDAGGIAIEFPVHPIQETGKRPTAGLDRNLAYLGLVEALYGYPLDGVV 143

Query: 124 LTTGCDKTTPACLMAAATTDLPAIVLSGGPMLDGHHKGELIGSGTVLWHARNLMAAGEID 183
           LT GCDKTTPACLMAAAT ++PAI LS GPML+G HKGE  GSGT++W AR ++AAGEID
Sbjct: 144 LTIGCDKTTPACLMAAATVNIPAIALSVGPMLNGWHKGERTGSGTIVWKARQMLAAGEID 203

Query: 184 YEGFMEMTTAASPSVGHCNTMGTALSMNALAEALGMSLPGCASIPAPYRERGQMAYATGK 243
            + F+ +  +++PS G+CNTMGTA +MN+LAEALGMSLPG A+IPAP+R+R ++AY TG 
Sbjct: 204 DDEFIRLVASSAPSTGYCNTMGTATTMNSLAEALGMSLPGSAAIPAPHRDRQEVAYQTGL 263

Query: 244 RICDLVRQDIRPSQIMTRQAFENAIAVASALGASSNCPPHLIAIARHMGVELSLEDWQRI 303
           R  +LVR D++PS I+TR+AFENAI V SA+G S+N P HL AIARH+GV+L ++ WQ  
Sbjct: 264 RAVELVRADVKPSDILTREAFENAIVVNSAIGGSTNAPIHLAAIARHIGVDLPIDAWQEK 323

Query: 304 GEDVPLLVNCMPAGKYLGEGFHRAGGVPSVMHELQKAGRLHEDCATVSGKTIGEIVSNSL 363
           G  VPLLVN  PAG+YLGE ++RAGGVP+V+ +L  AG +HED  TV+GK+IG       
Sbjct: 324 GHAVPLLVNLQPAGEYLGEDYYRAGGVPAVVSQLIDAGLIHEDAGTVNGKSIGANCRGVA 383

Query: 364 TSNTDVIHPFDTPLKHRAGFIVLSGNFFDSAIMKMSVVGEAFRKTYLSEPGAENSFEARA 423
             +  VI PF  PLK  AGFIVL GN F+SAIMK SV+ + FR  YLS P   ++FE  A
Sbjct: 384 IEDEKVIRPFAQPLKDAAGFIVLRGNLFESAIMKTSVISDEFRDRYLSNPDDPDAFEGPA 443

Query: 424 IVFEGPEDYHARIDDPALDIDERCILVIRGVGTVGYPGSAEVVNMAPPAALIKQGIDSLP 483
           +VF+GPEDYHARIDDPAL I    +L +RG G VGYPG+AEVVNM PPA LI++GI +LP
Sbjct: 444 VVFDGPEDYHARIDDPALGITPETLLFMRGAGPVGYPGAAEVVNMRPPAYLIREGIHALP 503

Query: 484 CLGDGRQSGTSASPSILNMSPEAAVGGGLALLKTNDRLKVDLNTRTVNLLIDDAEMAQRR 543
           C+GDGRQSGTS SPSILN SPEAA  GGLAL++T DR+++DL   T ++LI  AE+A+RR
Sbjct: 504 CIGDGRQSGTSGSPSILNASPEAAAMGGLALIRTGDRVRIDLGKGTADVLIPSAELAERR 563

Query: 544 REWIP----NIPPSQTPWQELYRQLVGQLSTGGCLEPATLHLRVIARSGEPRHSH 594
           R          PPSQTPWQE+ R+LVGQ+ +G  LE A    R+    G PR +H
Sbjct: 564 RVLAEAGGYRFPPSQTPWQEIQRKLVGQMESGAILEGAERFQRIAQTQGLPRDNH 618


Lambda     K      H
   0.319    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1171
Number of extensions: 48
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 594
Length of database: 618
Length adjustment: 37
Effective length of query: 557
Effective length of database: 581
Effective search space:   323617
Effective search space used:   323617
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory