Align L-iditol 2-dehydrogenase; EC 1.1.1.14 (characterized)
to candidate Ga0059261_2605 Ga0059261_2605 Threonine dehydrogenase and related Zn-dependent dehydrogenases
Query= CharProtDB::CH_000596 (353 letters) >FitnessBrowser__Korea:Ga0059261_2605 Length = 341 Score = 151 bits (381), Expect = 3e-41 Identities = 102/329 (31%), Positives = 163/329 (49%), Gaps = 10/329 (3%) Query: 12 AVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEKPFILGHE 71 A +H I PVP D++LI+V ICG+DLH Y + P I+GHE Sbjct: 5 AKLHAREGIWETEAPVPTPGPDDILIRVRRTAICGTDLHIYNWDDWAARTIPVPMIVGHE 64 Query: 72 CAGEIAAVGSSVDQ-FKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLATPPVDGAFV 130 +GEI +G +V + +G RV+ E + A + GR++L P + GAF Sbjct: 65 FSGEIVEIGEAVTRPLCIGQRVSGEGHIIDFDSSAARAGRFHLDPGTVGVGVNR-QGAFA 123 Query: 131 QYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTIAIMGMGPVGLMAVA 190 Y+ + V +PD +S + AL++PF +H A + L G + + G GP+G+MA A Sbjct: 124 DYLCIPAFNVVPLPDDVSDDVGALLDPFGNAVHTAQQFDLM-GEDVLVTGAGPIGIMAAA 182 Query: 191 AAKAFGAGTIIVTDLEPLRLEAAKKMGATHIINIREQDALEEIKTITNDRGVDVAWETAG 250 A+ GA ++++TD+ P RL+ A ++ +N E+D E + D G VA E +G Sbjct: 183 VARRAGARSVVITDINPYRLDLAARLADVRPVNTLEEDLREVMAAEGIDDGFAVALEMSG 242 Query: 251 NPAALQSALASVRRGGKLAIVGLPSQNEIPLNVPFIADNEIDIYGIF--RYANTYPKGIE 308 P A+ A+ ++R GG LA++G+P + + I + I G++ T+ K Sbjct: 243 APVAINQAIGALRMGGGLAMLGIPG-GSMDVAWSDIILKALTIRGVYGREMFGTWQKMFG 301 Query: 309 FLASGIVDTKHLVT---DQYSLEQTQDAM 334 + G+ D L+T D +Q DAM Sbjct: 302 LIRGGL-DLSPLITHRLDARDFQQGFDAM 329 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 341 Length adjustment: 29 Effective length of query: 324 Effective length of database: 312 Effective search space: 101088 Effective search space used: 101088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory