Align D-xylose reductase (EC 1.1.1.307) (characterized)
to candidate Ga0059261_0885 Ga0059261_0885 Predicted oxidoreductases (related to aryl-alcohol dehydrogenases)
Query= BRENDA::F2YCN5 (340 letters) >FitnessBrowser__Korea:Ga0059261_0885 Length = 344 Score = 140 bits (353), Expect = 5e-38 Identities = 93/289 (32%), Positives = 146/289 (50%), Gaps = 12/289 (4%) Query: 38 WGGTDDDASIKTIHRAIDLGINIIDTAPAYGRGHAEEVVGKAIKGQRDNLIIATKVGLDW 97 WG +D + + + +D G+N+ DTA Y G +EEV+ +AIKG+RD ++I+TK GL Sbjct: 33 WGTSDAAEARRLVDICLDAGVNLFDTADVYSNGASEEVLAEAIKGRRDQVLISTKTGLP- 91 Query: 98 TLTPDQSMRRNSSASRIKKEIEDSLRRLGTDYIDLYQVHWPDPLVPIEETATILEALRKE 157 D S SR+ ++ SL+RLGTD+ID+ Q+H D P+EE L+ L + Sbjct: 92 --LGDGPADWGVSRSRLIAAVDASLKRLGTDHIDILQLHAFDAHTPVEELLATLDTLVAQ 149 Query: 158 GKIRSIGVSNYSVQQMDEFKKYAE------LAVSQSPYNLFEREIDKDILPYAKKNDLVV 211 GK+R GVSNY Q+ + A+ Q Y+L R + D++P A + Sbjct: 150 GKVRHTGVSNYPGWQLMKALAAADRHGWPRFVAHQVYYSLIGRAYEADLMPLAADQGIGA 209 Query: 212 LGYGALCRGLLSGRMTADRAFTGDDLRKTDPKFQKPRFEHYLAAVEELKKLAKEHYNKSV 271 L + L G L+G++ +R +F P E +L V + + E K+V Sbjct: 210 LVWSPLGWGRLTGKIGRNRPVPAGSRLHDTEQFAPPVSEEHLYKVIDALEAVAEETGKTV 269 Query: 272 LALAIRWMLEQGPTLA--LWGACKPEQIDGIDEVFGWQISDEDLKQIDA 318 +AI W+L Q PT++ + GA EQ+ GW ++ E + +DA Sbjct: 270 PQVAINWLL-QRPTVSSVIIGARNEEQLRQNLGAVGWSLTREQVAALDA 317 Lambda K H 0.317 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 340 Length of database: 344 Length adjustment: 29 Effective length of query: 311 Effective length of database: 315 Effective search space: 97965 Effective search space used: 97965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory