Protein BWI76_RS01840 in Klebsiella michiganensis M5al
Annotation: BWI76_RS01840 ABC transporter ATP-binding protein
Length: 369 amino acids
Source: Koxy in FitnessBrowser
Candidate for 33 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-maltose catabolism | malK | hi | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) | 95% | 100% | 700.7 | ABC transporter for D-Sorbitol, ATPase component | 56% | 383.3 |
D-sorbitol (glucitol) catabolism | mtlK | med | ABC transporter for D-Sorbitol, ATPase component (characterized) | 56% | 98% | 383.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-mannitol catabolism | mtlK | med | ABC transporter for D-Mannitol, D-Mannose, and D-Sorbitol, ATPase component (characterized) | 54% | 98% | 377.9 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
sucrose catabolism | thuK | med | ABC transporter (characterized, see rationale) | 56% | 94% | 369 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
lactose catabolism | lacK | med | LacK, component of Lactose porter (characterized) | 55% | 100% | 365.5 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-maltose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 53% | 100% | 357.1 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-maltose catabolism | thuK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 53% | 100% | 357.1 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
sucrose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 53% | 100% | 357.1 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
trehalose catabolism | aglK | med | ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) | 53% | 100% | 357.1 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-cellobiose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 53% | 95% | 351.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-glucose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 53% | 95% | 351.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
lactose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 53% | 95% | 351.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-maltose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 53% | 95% | 351.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-mannose catabolism | TT_C0211 | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 53% | 95% | 351.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
sucrose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 53% | 95% | 351.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
trehalose catabolism | gtsD | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 53% | 95% | 351.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
trehalose catabolism | thuK | med | Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) | 53% | 95% | 351.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-cellobiose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 52% | 98% | 344.7 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-glucose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 52% | 98% | 344.7 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
lactose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 52% | 98% | 344.7 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-maltose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 52% | 98% | 344.7 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
sucrose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 52% | 98% | 344.7 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
trehalose catabolism | aglK' | med | Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) | 52% | 98% | 344.7 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
xylitol catabolism | Dshi_0546 | med | ABC transporter for Xylitol, ATPase component (characterized) | 50% | 100% | 322.4 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-maltose catabolism | malK_Sm | med | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 50% | 89% | 317 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
trehalose catabolism | malK | med | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 50% | 89% | 317 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
N-acetyl-D-glucosamine catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 64% | 74% | 314.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-glucosamine (chitosamine) catabolism | SMc02869 | med | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 64% | 74% | 314.3 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
L-arabinose catabolism | xacK | med | Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) | 46% | 96% | 300.4 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
L-arabinose catabolism | xacJ | med | Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) | 45% | 98% | 296.6 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-maltose catabolism | malK_Bb | med | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 46% | 100% | 296.6 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
D-glucosamine (chitosamine) catabolism | SM_b21216 | med | ABC transporter for D-Glucosamine, ATPase component (characterized) | 45% | 98% | 285.8 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
trehalose catabolism | treV | med | TreV, component of Trehalose porter (characterized) | 46% | 78% | 234.2 | Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 | 95% | 700.7 |
Sequence Analysis Tools
View BWI76_RS01840 at FitnessBrowser
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Search PFam (including for weak hits, up to E = 1)
Predict protein localization: PSORTb (Gram negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the SEED with FIGfam search
Fitness BLAST: loading...
Sequence
MASVQLRNVTKAWGDVVVSKDINLEIQDGEFVVFVGPSGCGKSTLLRMIAGLETVTSGDL
LIGDTRMNDVPPAERGIGMVFQSYALYPHLSVAENMSFGLKLAGAKKELINQRVTQVAEV
LQLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEPLSNLDAALRVQMRIEISRLH
KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN
FLPVKVTATAIEQVQVELPNRQQVWLPVDSARVQVGANMSLGIRPEHLLPSDIADVTLEG
EVQVVEQLGHETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTAC
RRLHKEPGV
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory