GapMind for catabolism of small carbon sources

 

Protein BWI76_RS07240 in Klebsiella michiganensis M5al

Annotation: BWI76_RS07240 D-ribose transporter ATP-binding protein

Length: 494 amino acids

Source: Koxy in FitnessBrowser

Candidate for 29 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
myo-inositol catabolism PS417_11890 hi m-Inositol ABC transporter, ATPase component (itaA) (characterized) 59% 94% 584.3 Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter 51% 503.4
D-cellobiose catabolism mglA med Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 51% 97% 503.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-galactose catabolism mglA med Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 51% 97% 503.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-glucose catabolism mglA med Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 51% 97% 503.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
lactose catabolism mglA med Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 51% 97% 503.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-maltose catabolism mglA med Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 51% 97% 503.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
sucrose catabolism mglA med Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 51% 97% 503.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
trehalose catabolism mglA med Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 51% 97% 503.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-ribose catabolism rbsA med ribose transport, ATP-binding protein RbsA; EC 3.6.3.17 (characterized) 49% 97% 473.8 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-xylose catabolism xylG med Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 47% 99% 452.6 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
L-fucose catabolism HSERO_RS05250 med Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale) 48% 95% 446.8 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-galactose catabolism BPHYT_RS16930 med Arabinose import ATP-binding protein AraG; EC 7.5.2.12 (characterized, see rationale) 47% 96% 438.7 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-xylose catabolism xylK_Tm med Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale) 48% 95% 431.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
L-arabinose catabolism araG med L-arabinose ABC transporter, ATP-binding protein AraG; EC 3.6.3.17 (characterized) 47% 97% 425.2 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
L-rhamnose catabolism rhaT' med RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized) 46% 96% 425.2 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-mannose catabolism HSERO_RS03640 med Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale) 45% 94% 419.9 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
xylitol catabolism PS417_12065 med D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale) 46% 99% 416.4 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
L-arabinose catabolism gguA med GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized) 44% 97% 400.6 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-galactose catabolism gguA med GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized) 44% 97% 400.6 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-galactose catabolism ytfR med galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized) 42% 94% 392.1 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-fructose catabolism frcA med ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) 44% 93% 377.1 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
myo-inositol catabolism iatA med Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) 43% 96% 377.1 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
sucrose catabolism frcA med ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) 44% 93% 377.1 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
L-arabinose catabolism araVsh med ABC transporter related (characterized, see rationale) 42% 95% 374.8 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
D-fructose catabolism fruK lo Fructose import ATP-binding protein FruK; EC 7.5.2.- (characterized) 40% 96% 363.2 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
sucrose catabolism fruK lo Fructose import ATP-binding protein FruK; EC 7.5.2.- (characterized) 40% 96% 363.2 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
2'-deoxyinosine catabolism H281DRAFT_01113 lo deoxynucleoside transporter, ATPase component (characterized) 37% 93% 335.1 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
2'-deoxyinosine catabolism nupA lo RnsB, component of The (deoxy)ribonucleoside permease; probably takes up all deoxy- and ribonucleosides (cytidine, uridine, adenosine and toxic analogues, fluorocytidine and fluorouridine tested), but not ribose or nucleobases (characterized) 36% 97% 314.7 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3
myo-inositol catabolism PGA1_c07320 lo Inositol transport system ATP-binding protein (characterized) 38% 96% 173.3 m-Inositol ABC transporter, ATPase component (itaA) 59% 584.3

Sequence Analysis Tools

View BWI76_RS07240 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices: TMHMM

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MNAFALEAEGISKFFPGVKALDNVSLRVRPGTVHALMGENGAGKSTLMKCLIGIYRPDKG
AIRVKGEPVQFQDTMDALRSGISMIHQELNLVPHMTVAENIWLGREPMKYGFVDHRQLAR
QTQDLLDKLNIRLSADRLVGELSIASQQMVEIAKAVSWNADIVIMDEPTSALTESEVAHL
FTIIRDLRQQGKAIIYISHKMDEIFAITDEISVFRDGTWVGSKQTTEFTRQSLITQMVGR
ELTQLFPKFNNAIGEEVLTVRNLSRKGAFHDINFSVRRGEILGVAGLVGAGRSEVMESLF
GMEKADSGEVLIDGMPVNIDSPSTAIEKGMALLTEDRKKSGLFLVLSVLENMSIVKMPEY
IGKTGFVQHLKMAEDCMEQIRRLNIKTPTMDQIINNLSGGNQQKVLIARWLLAQPKILIL
DEPTRGIDVGAKAEIYHLISELANRGVAVIMVSSELPEILGMSDRVMVMHEGRITGILDK
EDADQETILSLASH

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory