GapMind for catabolism of small carbon sources

 

Protein BWI76_RS07245 in Klebsiella michiganensis M5al

Annotation: BWI76_RS07245 ABC transporter

Length: 343 amino acids

Source: Koxy in FitnessBrowser

Candidate for 16 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
myo-inositol catabolism PS417_11895 hi m-Inositol ABC transporter, permease component (iatP) (characterized) 69% 98% 457.2 Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR 41% 233.0
xylitol catabolism PS417_12060 med ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) 43% 100% 263.8 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
D-cellobiose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 233 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
D-glucose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 233 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
lactose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 233 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
D-maltose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 233 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
sucrose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 233 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
trehalose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 233 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
D-xylose catabolism xylH med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 233 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
D-ribose catabolism rbsC med Ribose import permease protein RbsC (characterized) 42% 93% 224.2 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
myo-inositol catabolism iatP med Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) 40% 95% 217.2 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
D-galactose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 39% 99% 220.3 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
D-fructose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 39% 89% 206.1 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
sucrose catabolism frcC lo Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 39% 89% 206.1 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
L-fucose catabolism HSERO_RS05255 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 37% 88% 203.8 m-Inositol ABC transporter, permease component (iatP) 69% 457.2
D-xylose catabolism xylF_Tm lo ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized) 38% 98% 199.5 m-Inositol ABC transporter, permease component (iatP) 69% 457.2

Sequence Analysis Tools

View BWI76_RS07245 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MSNMKITATPVTEKPSFFGQLRHRLPKDTGIFIVMLVIALTFEIAGWYVRDQSFLLNTNR
LILIVLQVAIIGIIAVGVTQVIITTGIDLSSGSVIALAAVVAASLAQTSDSLSPMFPSLV
NMPAIIPIGAGIGVGLLCGLTNGFLVTRTGIPPFIATLGMMVSARGLAQYYTQGNPISFL
SDSFTAIGQGAMPVIIFFVVAAVFHIALKHTRYGKYVYAIGGNMTSAKVSGINVNKYLVI
VYAIAGALSGLAGVVLAARVSSGQSSMGMSYELDAIAAAVIGGSSLMGGVGRITGTLIGA
MILGLIKSGFTFVGVDAYVQDIIKGIIIVAAVTIDMRRNRKKH

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory