GapMind for catabolism of small carbon sources

 

Protein BWI76_RS07275 in Klebsiella michiganensis M5al

Annotation: BWI76_RS07275 ABC transporter

Length: 368 amino acids

Source: Koxy in FitnessBrowser

Candidate for 15 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-isoleucine catabolism livM hi ABC transporter ATP-binding protein (characterized, see rationale) 63% 94% 434.9 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 148.7
L-leucine catabolism livM hi ABC transporter ATP-binding protein (characterized, see rationale) 63% 94% 434.9 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 148.7
L-phenylalanine catabolism livM hi ABC transporter ATP-binding protein (characterized, see rationale) 63% 94% 434.9 ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM 33% 174.5
L-proline catabolism HSERO_RS00890 hi ABC transporter ATP-binding protein (characterized, see rationale) 63% 94% 434.9 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 44% 250.4
L-serine catabolism Ac3H11_1694 hi ABC transporter ATP-binding protein (characterized, see rationale) 63% 94% 434.9 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 44% 250.4
L-tyrosine catabolism Ac3H11_1694 hi ABC transporter ATP-binding protein (characterized, see rationale) 63% 94% 434.9 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 44% 250.4
L-arginine catabolism braE med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 43% 73% 262.3 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 44% 250.4
L-glutamate catabolism braE med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 43% 73% 262.3 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 44% 250.4
L-histidine catabolism braE med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 43% 73% 262.3 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 44% 250.4
L-valine catabolism livM med Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 43% 73% 262.3 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 148.7
L-alanine catabolism braE med High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 44% 78% 250.8 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 43% 238.8
L-serine catabolism braE med High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 44% 78% 250.8 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 43% 238.8
L-threonine catabolism braE med High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 44% 78% 250.8 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 43% 238.8
D-alanine catabolism AZOBR_RS08240 lo Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale) 41% 64% 233.8 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 44% 250.4
L-proline catabolism AZOBR_RS08240 lo Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale) 41% 64% 233.8 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 44% 250.4

Sequence Analysis Tools

View BWI76_RS07275 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search PFam (including for weak hits, up to E = 1)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices: TMHMM

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MTTLQLDTPAVSRRFWSGMTLLVCALLVAPMVASQLGGNYWVRVIDFALLYVMLALGLNI
VVGYTGLLDMGFIAFYAVGAYLAALLASPHLLDVFPILNSWFPDGLHTSWLVIIPLAALV
AAGCGIVLGAPTLKLRGDYLAIVTLGFGEIIRILMRNLDRPVNITNGAKGISGVDSLNLF
GLKFSGVYHWFGFKVPALWLWYYLLMLVIVAIIFVCLRLQHSRIGRAWHAIREDEDVARA
MGINLRNYKLLAFAIGASFGGVAGALFGAFQGFVSPESFTLQESIAVLAMVVLGGMGHIP
GVILGAVLLTALPELLRSQAAPVQQALFGEVLIDPEVLRQLFYGLALVLVMLLRPQGIWP
ARHQGAKA

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory