Protein BWI76_RS17900 in Klebsiella michiganensis M5al
Annotation: FitnessBrowser__Koxy:BWI76_RS17900
Length: 283 amino acids
Source: Koxy in FitnessBrowser
Candidate for 11 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
D-cellobiose catabolism | manZ | hi | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) | 93% | 100% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
D-fructose catabolism | levG | hi | PTND aka MANZ aka PTSM aka GPTB aka B1819, component of The mannose (glucose, 2-deoxyglucose, glucosamine, N-acetylglucosamine, N-acetylmannosamine, mannosamine and fructose) PTS porter/group translocator, ManXYZ (Rephaeli and Saier 1980; Plumbridge 2015). Catalyzes xylose facilitated diffusion in lactobacilli. The order of D-sugar substrate affinities is: glucose > mannose > 2-deoxyglucose > N-acetylglucosamine > glucosamine > N-acetylmannosamine > mannosamine > fructose (characterized) | 93% | 99% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
D-glucosamine (chitosamine) catabolism | manZ | hi | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) | 93% | 100% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
D-glucose catabolism | manZ | hi | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) | 93% | 100% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
lactose catabolism | manZ | hi | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) | 93% | 100% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
D-maltose catabolism | manZ | hi | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) | 93% | 100% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
D-mannose catabolism | manZ | hi | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) | 93% | 100% | 525.8 | PTS system sorbose-specific EIID component; EIID-Sor; Sorbose permease IID component | 64% | 353.2 |
sucrose catabolism | levG | hi | PTND aka MANZ aka PTSM aka GPTB aka B1819, component of The mannose (glucose, 2-deoxyglucose, glucosamine, N-acetylglucosamine, N-acetylmannosamine, mannosamine and fructose) PTS porter/group translocator, ManXYZ (Rephaeli and Saier 1980; Plumbridge 2015). Catalyzes xylose facilitated diffusion in lactobacilli. The order of D-sugar substrate affinities is: glucose > mannose > 2-deoxyglucose > N-acetylglucosamine > glucosamine > N-acetylmannosamine > mannosamine > fructose (characterized) | 93% | 99% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
sucrose catabolism | manZ | hi | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) | 93% | 100% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
trehalose catabolism | manZ | hi | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component (characterized) | 93% | 100% | 525.8 | Lmo0781 protein, component of Constitutively synthesized sensor, MpoABCD, controlling man operon (see TC# 4.A.6.1.15) expression by interacting with and phosphorylating ManR, the transcriptional regulator of the man operon | 74% | 432.6 |
D-gluconate catabolism | gntEIID | lo | PTS system, IID component, component of The gluconate PTS uptake system. IIAGnt and IIBGnt form a high affinity 2:2 heterotetrameric complex (characterized) | 32% | 98% | 131 | PTS system mannose-specific EIID component; EII-M-Man; EIID-Man; Mannose permease IID component | 93% | 525.8 |
Sequence Analysis Tools
View BWI76_RS17900 at FitnessBrowser
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MVDMTKNTTEKKLTQSDIRGVFIRSNLFQGSWNFERMQALGFCFSMVPAIRRLYPENNDA
RKQAIKRHLEFFNTHPYVAAPVLGVTLAMEEQRANGAEIDDGAINGIKVGLMGPLAGVGD
PIFWGTVRPVFAALGAGIAMSGSLLGPLLFFILFNAVRLLTRYYGVAYGYRKGIDIVKDM
GGGFLQKLTEGASILGLFVMGALVNKWTHVNIPLVVSTITGQDGQTRVTTVQTILDQLMP
GLVPLLLTFACMWLLRKKVNALWIIVGFFVIGIAGYAVGLLGQ
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory