GapMind for catabolism of small carbon sources

 

Protein BWI76_RS22070 in Klebsiella michiganensis M5al

Annotation: FitnessBrowser__Koxy:BWI76_RS22070

Length: 354 amino acids

Source: Koxy in FitnessBrowser

Candidate for 4 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-proline catabolism proW hi Glycine betaine/proline betaine transport system permease protein ProW (characterized) 91% 100% 649 Glycine betaine transport system permease protein OpuAB 47% 256.9
L-histidine catabolism hutW med ABC transporter for L-Histidine, permease component (characterized) 48% 94% 241.5 Glycine betaine/proline betaine transport system permease protein ProW 91% 649.0
L-proline catabolism hutW med HutW aka HISW, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 44% 99% 234.6 Glycine betaine/proline betaine transport system permease protein ProW 91% 649.0
L-proline catabolism opuBB lo BusAB aka OPUABC, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 46% 53% 242.7 Glycine betaine/proline betaine transport system permease protein ProW 91% 649.0

Sequence Analysis Tools

View BWI76_RS22070 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MADQSNPWDTAPAADSAAQSADAWGTSTPAPTNGGSADWLSSAPAPQPEHFNIMDPFHNT
LIPLDSWVTHGIDWVVMHFRPLFQGIRVPVDYILSAFQQLLLGMPAPVAIIIFSLIAWQI
SSVGMGAATLISLIAIGAIGAWSQAMVTLALVLTALLFCMLIGLPLGIWLARSPRAAKII
RPLLDAMQTTPAFVYLVPIVMLFGIGNVPGVVVTIIFALPPIVRLTILGINQVPADLIEA
SRSFGASPRQLLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGR
LDMGLATVGGVGIVILAIILDRLTQAVGRDSRSRGNRRWYATGPLGLITRPFCK

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory