Align BadH (characterized)
to candidate BWI76_RS23705 BWI76_RS23705 3-oxoacyl-ACP reductase
Query= metacyc::MONOMER-893 (255 letters) >FitnessBrowser__Koxy:BWI76_RS23705 Length = 244 Score = 162 bits (409), Expect = 8e-45 Identities = 92/251 (36%), Positives = 140/251 (55%), Gaps = 8/251 (3%) Query: 3 RLQNKTAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRC 62 +L +KTA++TG GIG + A+EGA++ + D + E A ++R++G A + C Sbjct: 2 KLASKTAIVTGAARGIGFGIAQVLAREGARVIIADRDAHG-EAAAASLRESGAQALFISC 60 Query: 63 DIADRTSVDAAIATTTTTLGPVDILVNNAGWDIFKPFTKTEPGEWERLIAINLTGALHMH 122 +I D+ V+A + G VDI+VNNAG + K +W+ +I +NL G Sbjct: 61 NIGDKAQVEALFSQAEEAFGAVDIVVNNAGINRDAMLHKLSEADWDTVIDVNLKGTFLCM 120 Query: 123 HAVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVNV 182 M ER GRI+NIAS A+ +G+ G+ Y+A K G+V +KT RE A+ G+TVN Sbjct: 121 QQAAIRMRERGAGRIINIAS-ASWLGNVGQTNYSASKAGVVGMTKTACRELAKKGVTVNA 179 Query: 183 VCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAFFGSDDAGFITG 242 +CPG DT D+T G PE + + IP G G+ D+ +AF SD A +I G Sbjct: 180 ICPGFIDT----DMTRGV--PENVWQIMINKIPAGYAGEAKDVGECVAFLASDGARYING 233 Query: 243 QVLSVSGGLTM 253 +V++V GG+ + Sbjct: 234 EVINVGGGMVL 244 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 244 Length adjustment: 24 Effective length of query: 231 Effective length of database: 220 Effective search space: 50820 Effective search space used: 50820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory