Align Benzoyl-CoA reductase subunit D; 3-hydroxybenzoyl-CoA reductase subunit delta; EC 1.3.7.8; EC 1.3.99.n1 (characterized)
to candidate BWI76_RS03740 BWI76_RS03740 hypothetical protein
Query= SwissProt::O87877 (282 letters) >FitnessBrowser__Koxy:BWI76_RS03740 Length = 255 Score = 129 bits (325), Expect = 5e-35 Identities = 92/267 (34%), Positives = 145/267 (54%), Gaps = 23/267 (8%) Query: 1 MTITAGIDIGTGAVKTVLFRVEGDKTEWLAKRNDRIRQRDPFKLAE---EAYNGLLEEAG 57 MT+T GID G+ A K +L + + +R R PF+ A+ EA+ L AG Sbjct: 1 MTVTVGIDSGSTATKGILL------ADGVIQR--RFLCPTPFRPADAIVEAWETL--RAG 50 Query: 58 LKASDVDYVATTGEGESLA-FHTGHFYSMTTHARGAVYLNPEARAVLDIGALHGRAIRND 116 L S+ ++ TG G L F ++ H GA L P+ R V+DIG + I+ D Sbjct: 51 L--SERPFLTLTGYGRQLVDFADKQVTEISCHGLGARLLAPQTRTVIDIGGQDSKVIQLD 108 Query: 117 ERGKVETYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSTQADNPEVVSSICAVLAETD 176 + G + + M +CA+G+G+FLE I+R LG + D++ S+ T+ P ++S+C V AE++ Sbjct: 109 DAGNLTDFLMNDKCAAGTGRFLEVISRTLGASVDQLDSI-TEGVEPHAITSMCTVFAESE 167 Query: 177 VINMVSRGISAPNILKGIHISMAGRLAKLLKSVGARDGVVLCTGGLALDEGLLKTLNESI 236 VI++ S G+ IL G+ +MA R A + + A+ G +L TGG++ + L Sbjct: 168 VISLRSAGVPPEAILAGVINAMARRSANFIGRLSAQ-GPLLFTGGVSRCAAFARRL---- 222 Query: 237 QEQKMAVVAYNHPDSPYAGAIGAALWG 263 E+ + + HPD+ +AGAIGAAL G Sbjct: 223 -EEHVGMAVQTHPDAQFAGAIGAALIG 248 Lambda K H 0.316 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 255 Length adjustment: 25 Effective length of query: 257 Effective length of database: 230 Effective search space: 59110 Effective search space used: 59110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory