Align crotonase (EC 4.2.1.150) (characterized)
to candidate BWI76_RS20455 BWI76_RS20455 multifunctional fatty acid oxidation complex subunit alpha
Query= metacyc::MONOMER-13469 (259 letters) >FitnessBrowser__Koxy:BWI76_RS20455 Length = 714 Score = 120 bits (302), Expect = 6e-32 Identities = 78/187 (41%), Positives = 108/187 (57%), Gaps = 5/187 (2%) Query: 13 NVASITLNRP-KALNALNAATLKEIDAAINDIAEDDNVY-AVIITGSGKAFVAGADIAEM 70 N+A IT++ P + +N L A E+ I I ++ + AV I+ F+AGADI + Sbjct: 15 NIAVITIDAPGEKMNTLKAEFASEVRGIIRQIRDNKELRGAVFISAKPDNFIAGADINMI 74 Query: 71 KDL-TAVEGRKFSVLGNKIFRKLENLEKPVIAAINGFALGGGCELSLSCDIRIASS--KA 127 +A E + G +I ++ L PVIAAI+G LGGG EL+L+C R+ S K Sbjct: 75 ARCHSAQEAEALARQGQQIMAEIHGLSIPVIAAIHGACLGGGLELALACHGRVCSDDDKT 134 Query: 128 KFGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVNKVVEPDKL 187 + G PEV LG+ PG GGTQRL R IGV A E+I TGK + +AL+ GLV++VV L Sbjct: 135 RLGLPEVQLGLLPGSGGTQRLPRLIGVSGALEMILTGKQLRPRQALKAGLVDEVVAQTIL 194 Query: 188 LEEAKAL 194 L+ A L Sbjct: 195 LQTAVEL 201 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 714 Length adjustment: 32 Effective length of query: 227 Effective length of database: 682 Effective search space: 154814 Effective search space used: 154814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory