Align 4-oxalomesaconate tautomerase; Gallate degradation protein D; EC 5.3.2.8 (characterized)
to candidate BWI76_RS04370 BWI76_RS04370 FldA family protein
Query= SwissProt::Q88JY0 (361 letters) >FitnessBrowser__Koxy:BWI76_RS04370 Length = 351 Score = 320 bits (819), Expect = 5e-92 Identities = 173/348 (49%), Positives = 220/348 (63%), Gaps = 4/348 (1%) Query: 6 IPCLLMRGGTSKGAYFLHDDLPAPGPLRDRVLLAVMGSPDARQIDGIGGADSLTSKVAII 65 IPC+LMRGGTSKGA+ L DDLP RD LLA+MGS +IDGIGG TSKVAII Sbjct: 4 IPCVLMRGGTSKGAFLLADDLPKDIQKRDDCLLAIMGSGHELEIDGIGGGSPQTSKVAII 63 Query: 66 RASQRDDADVDYLFAQVVVDEARVDYGQNCGNILAGVGPFALERGLVAASGASTPVRIFM 125 S ++AD+DYLF QV+V+E RVD NCGN+L VG FA+E GLV A+ T VRI Sbjct: 64 SQSLSEEADIDYLFVQVIVNERRVDTTPNCGNMLCAVGGFAIEHGLVEAASPVTRVRIRN 123 Query: 126 ENTGQIAVAQVPTADGQVEYAGDTRIDGVPGRAAALVVTFADVAGASCGALLPTGNSRDC 185 NT A V T DG+V Y GD++IDGVPGRAA + +TF + AGA G L PTGN D Sbjct: 124 VNTNTFIDADVQTPDGKVIYEGDSQIDGVPGRAAPVALTFLNAAGAKSGRLFPTGNRMDV 183 Query: 186 VEGVEVTCIDNGMPVVLLCAEDLGVTGYEPCETLEADSALKTRLEAIRLQLGPRMNLGDV 245 + V VTCID MP+V++ A+ LG TGYE L+ DS L LE+IR+Q G M GDV Sbjct: 184 FDDVRVTCIDMAMPMVVIPAQSLGKTGYESASELDRDSGLLKSLESIRIQAGKAMGFGDV 243 Query: 246 SQRNVPKMCLLSAPRNGGTVNTRSFIPHRCHASIGVFGAVSVATACLIEGSVAQGLASTS 305 + +PK L+S +GG++N R F+PH CH S+ + GA+ +A+AC+I ++A L S Sbjct: 244 TNMVIPKPVLISPALSGGSINVRYFMPHNCHKSLAITGAIGLASACIIPKTIANELTKLS 303 Query: 306 GGDRQRLAVEHPSGEFTVEIS--LEHGVIKGCGLVRTARLLFDGVVCI 351 G + VEHPSG V++S E ++RTAR + G V I Sbjct: 304 GDG--IIKVEHPSGGIEVDLSQTTERPEDIRASVIRTARKILSGTVYI 349 Lambda K H 0.320 0.138 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 351 Length adjustment: 29 Effective length of query: 332 Effective length of database: 322 Effective search space: 106904 Effective search space used: 106904 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory