GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pcaF in Klebsiella michiganensis M5al

Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate BWI76_RS16135 BWI76_RS16135 acetyl-CoA acetyltransferase

Query= metacyc::MONOMER-3207
         (400 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS16135 BWI76_RS16135 acetyl-CoA
           acetyltransferase
          Length = 400

 Score =  541 bits (1395), Expect = e-158
 Identities = 274/401 (68%), Positives = 325/401 (81%), Gaps = 2/401 (0%)

Query: 1   MRDVFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQA 60
           M   FICDA+RTP GRFGG LA +RADDLAA+PLKAL+E NP +   ++D+V +GCANQA
Sbjct: 1   MNQAFICDAVRTPFGRFGGTLATLRADDLAALPLKALLERNPGLDPARIDDVIYGCANQA 60

Query: 61  GEDNRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESM 120
           GEDNRNVARMALLLAGLPES+PG T+NRLC S +DAIG A RAI SGE +L IAGGVESM
Sbjct: 61  GEDNRNVARMALLLAGLPESVPGSTVNRLCGSSLDAIGIAARAIKSGETQLMIAGGVESM 120

Query: 121 SRAPFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRAD 180
           SRAPFVMGKAES +SR M++EDTTIGWRFINP MK+ YGVDSMPETA+NVADD+ +SRAD
Sbjct: 121 SRAPFVMGKAESAFSRTMRMEDTTIGWRFINPQMKALYGVDSMPETAENVADDFAISRAD 180

Query: 181 QDAFALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGETIV-ERDEHLRPETTLEALTKLKP 239
           QDAFALRSQ + AAAQ AG FA+E++ V +  +KGE ++  RDEH R  TT EAL +L+ 
Sbjct: 181 QDAFALRSQLRTAAAQEAGRFADELIAVSVPQRKGEPLLFSRDEHPR-TTTAEALARLRG 239

Query: 240 VNGPDKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPV 299
           V  PD TVTAGNASGVNDGA AL+LAS +A+  + L P ARV+G+A+ GVAPR+MG GP 
Sbjct: 240 VVRPDGTVTAGNASGVNDGACALLLASEQALAANDLQPLARVVGVATAGVAPRIMGFGPA 299

Query: 300 PAVRKLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLG 359
           PAVRK+  + G+ +   DVIELNEAFA+Q LAV R+LG+ DDA  VNPNGGAIALGHPLG
Sbjct: 300 PAVRKVLAQTGLTLGQMDVIELNEAFAAQALAVTRDLGLPDDAAYVNPNGGAIALGHPLG 359

Query: 360 MSGARLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIERV 400
            SG RL +TA +QL ++GGR  L TMC+GVGQG+AL IERV
Sbjct: 360 ASGGRLAMTAAYQLRRTGGRYALCTMCIGVGQGIALIIERV 400


Lambda     K      H
   0.318    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 543
Number of extensions: 18
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 400
Length adjustment: 31
Effective length of query: 369
Effective length of database: 369
Effective search space:   136161
Effective search space used:   136161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate BWI76_RS16135 BWI76_RS16135 (acetyl-CoA acetyltransferase)
to HMM TIGR02430 (pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02430.hmm
# target sequence database:        /tmp/gapView.481.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02430  [M=400]
Accession:   TIGR02430
Description: pcaF: 3-oxoadipyl-CoA thiolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                               -----------
   2.3e-222  724.1   9.8   2.6e-222  723.9   9.8    1.0  1  lcl|FitnessBrowser__Koxy:BWI76_RS16135  BWI76_RS16135 acetyl-CoA acetylt


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Koxy:BWI76_RS16135  BWI76_RS16135 acetyl-CoA acetyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  723.9   9.8  2.6e-222  2.6e-222       2     400 .]       3     400 .]       2     400 .] 1.00

  Alignments for each domain:
  == domain 1  score: 723.9 bits;  conditional E-value: 2.6e-222
                               TIGR02430   2 evyivdairtpiGrygGslssvraddlaavplkallarnpsldaaaiddvilGcanqaGednrnvarmaal 72 
                                             +++i+da+rtp+Gr+gG+l+++raddlaa+plkall+rnp ld a iddvi+GcanqaGednrnvarma+l
  lcl|FitnessBrowser__Koxy:BWI76_RS16135   3 QAFICDAVRTPFGRFGGTLATLRADDLAALPLKALLERNPGLDPARIDDVIYGCANQAGEDNRNVARMALL 73 
                                             79********************************************************************* PP

                               TIGR02430  73 laGlpvsvpgttvnrlcgsgldalglaaraikaGeadlviaGGvesmsrapfvlGkadsafsrsakledtt 143
                                             laGlp+svpg+tvnrlcgs+lda+g+aaraik+Ge++l+iaGGvesmsrapfv+Gka+safsr+ ++edtt
  lcl|FitnessBrowser__Koxy:BWI76_RS16135  74 LAGLPESVPGSTVNRLCGSSLDAIGIAARAIKSGETQLMIAGGVESMSRAPFVMGKAESAFSRTMRMEDTT 144
                                             *********************************************************************** PP

                               TIGR02430 144 iGwrfvnpklkalyGvdsmpetaenvaeefgvsredqdafalrsqqrtaaaqakGffaeeivpveikqkkG 214
                                             iGwrf+np++kalyGvdsmpetaenva++f++sr+dqdafalrsq rtaaaq++G fa+e++ v+++q+kG
  lcl|FitnessBrowser__Koxy:BWI76_RS16135 145 IGWRFINPQMKALYGVDSMPETAENVADDFAISRADQDAFALRSQLRTAAAQEAGRFADELIAVSVPQRKG 215
                                             *********************************************************************** PP

                               TIGR02430 215 eetvvdkdehlraettlealaklkavvredgtvtaGnasGvndGaaalllaseeavkrhgltprarilaaa 285
                                             e+  +++deh+r  tt eala+l++vvr+dgtvtaGnasGvndGa+alllase+a+++++l+p ar++++a
  lcl|FitnessBrowser__Koxy:BWI76_RS16135 216 EPLLFSRDEHPR-TTTAEALARLRGVVRPDGTVTAGNASGVNDGACALLLASEQALAANDLQPLARVVGVA 285
                                             ************.89******************************************************** PP

                               TIGR02430 286 saGveprvmGlgpvpavkkllaraglsledldvielneafaaqalavlrelgladddarvnpnGGaialGh 356
                                             +aGv+pr+mG+gp+pav+k+la++gl+l ++dvielneafaaqalav+r+lgl+dd+a vnpnGGaialGh
  lcl|FitnessBrowser__Koxy:BWI76_RS16135 286 TAGVAPRIMGFGPAPAVRKVLAQTGLTLGQMDVIELNEAFAAQALAVTRDLGLPDDAAYVNPNGGAIALGH 356
                                             *********************************************************************** PP

                               TIGR02430 357 plGasGarlvltalkqleksggryalatlciGvGqGialvierv 400
                                             plGasG rl++ta +ql+++ggryal+t+ciGvGqGial+ierv
  lcl|FitnessBrowser__Koxy:BWI76_RS16135 357 PLGASGGRLAMTAAYQLRRTGGRYALCTMCIGVGQGIALIIERV 400
                                             *******************************************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (400 nodes)
Target sequences:                          1  (400 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 11.10
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory