GapMind for catabolism of small carbon sources

 

Aligments for a candidate for praB in Klebsiella michiganensis M5al

Align 2-hydroxymuconate-6-semialdehyde dehydrogenase (EC 1.2.1.85) (characterized)
to candidate BWI76_RS10695 BWI76_RS10695 aldehyde dehydrogenase PuuC

Query= metacyc::MONOMER-15108
         (486 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS10695 BWI76_RS10695 aldehyde
           dehydrogenase PuuC
          Length = 495

 Score =  360 bits (925), Expect = e-104
 Identities = 202/488 (41%), Positives = 287/488 (58%), Gaps = 8/488 (1%)

Query: 2   QQTKVKPIDCLHFIDGKFVPSLDGKTFDNINPATEEKLGTVAEGGAAEIDLAVQAAKKAL 61
           Q+ +   I+   FI+G++  + D   F  I+PA ++ L  VA G  A++D AVQAA+   
Sbjct: 11  QKARELTIETRLFINGEYSAAADNSVFATIDPAAQQTLAEVARGKKADVDRAVQAARGVF 70

Query: 62  N-GPWKKMTANERIAVLRKVGDLILERKEELSVLESLDTGKPTWLSGSIDIPRAAYNFHF 120
           + G W + +  +R AVL K  DL+   +EEL++LE+LDTGKP   S   DIP AA    +
Sbjct: 71  DRGDWSQASPAQRKAVLTKFADLMDAHREELALLETLDTGKPIRHSLRDDIPGAARAIRW 130

Query: 121 FSDYIRTITNEATQMDDVALNYAIRRPVGVIGLINPWNLPLLLMTWKLAPALAAGNTVVM 180
           +++ I  +  E        L   +R P+GVI  + PWN PLLL  WKL PALA+GN+VV+
Sbjct: 131 YAEAIDKVYGEVAPTGGNELAMIVREPIGVIAAVVPWNFPLLLACWKLGPALASGNSVVL 190

Query: 181 KPAELTPMTATVLAEICRDAGVPDGVVNLVHGFGPNSAGAALTEHPDVNAISFTGETTTG 240
           KP+E +P+TA  LA + + AG+PDGV N+V GFG + AG AL  HPDV  I+FTG T T 
Sbjct: 191 KPSEKSPLTALRLAGLAKQAGLPDGVFNVVSGFG-HEAGQALALHPDVEVITFTGSTRTA 249

Query: 241 KIIMASAA-KTLKRLSYELGGKNPNVIFAD-SNLDEVIETTMKSSFINQGEVCLCGSRIY 298
           K ++  A    +KR+  E GGK+ N++FAD  +L + +  T    F NQG+VC+ G+R+ 
Sbjct: 250 KQLLKDAGDSNMKRVWLEAGGKSANIVFADCPDLQKAVNATAGGIFYNQGQVCIAGTRLL 309

Query: 299 VERPAYEAFLEKFVAKTKELVVGDPFDAKTKVGALISDEHYERVTGYIKLAVEEGGTILT 358
           +E    + FL+    + K    G+P D  T +G LI + H + V  +I+        +L 
Sbjct: 310 LEESIADRFLDLLKEQAKGWQPGNPLDPNTTMGMLIDNTHADSVHSFIRAGEAHSTLLLD 369

Query: 359 GGKRPEGLEKGYFLEPTIITGLTRDCRVVKEEIFGPVVTVIPFDTEEEVLEQINDTHYGL 418
           G K P     G    PTI   +     + +EEIFGPV+ V  F  EE+ L   ND+ YGL
Sbjct: 370 GRKNPWPAAVG----PTIFVDVDPASPLSQEEIFGPVLVVTRFKNEEQALALANDSRYGL 425

Query: 419 SASVWTNDLRRAHRVAGQIEAGIVWVNTWFLRDLRTPFGGMKQSGIGREGGLHSFEFYSE 478
            A+VWT DL RAHRV+ +++AG V+VN +   D+  PFGG KQSG GR+  LH+ E ++E
Sbjct: 426 GAAVWTRDLSRAHRVSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTE 485

Query: 479 LTNICIKL 486
           L  I I L
Sbjct: 486 LKTIWIAL 493


Lambda     K      H
   0.318    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 582
Number of extensions: 24
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 486
Length of database: 495
Length adjustment: 34
Effective length of query: 452
Effective length of database: 461
Effective search space:   208372
Effective search space used:   208372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory