Align 2-hydroxymuconate semialdehyde hydrolase; HMSH; EC 3.7.1.9; 2-hydroxymuconic semialdehyde hydrolase (uncharacterized)
to candidate BWI76_RS16915 BWI76_RS16915 alpha/beta hydrolase fold protein
Query= curated2:P19076 (283 letters) >FitnessBrowser__Koxy:BWI76_RS16915 Length = 288 Score = 137 bits (344), Expect = 4e-37 Identities = 93/267 (34%), Positives = 145/267 (54%), Gaps = 14/267 (5%) Query: 19 IRTNLHDSGAGFP-LMMIHGSGPGVTAWANW-RLVMPELAKSRRVIAPDMLGFGYSERPA 76 +R + +D G G ++++HGSGPG T WAN+ R + P + RVI D G+G S+ Sbjct: 24 LRIHFNDCGQGDETVVLLHGSGPGATGWANFSRNIDPLVEAGYRVILLDCPGWGKSDSIV 83 Query: 77 DAQYNRDVWVDHAVGVLDALEIEQADLVGNSFGGGIALALAIRHPERVRRLVLMG--SAG 134 ++ D+ V+D L+I + L+GNS GG A+A + PERV +LVLMG + G Sbjct: 84 NSGSRSDLNARVLKSVVDQLDISKVHLLGNSMGGHSAVAFTLTWPERVGKLVLMGGGTGG 143 Query: 135 VSF--PI-TEGLDAVWGY--NPSFAEMRRLLDIFAFDRNLVNDELAELRYQASIRPGFH- 188 +S P+ TEG+ + G P+ ++++++IF FD + D L R + H Sbjct: 144 MSLFTPMPTEGIKLLNGLYREPTIENLKKMMNIFVFDTRDLTDALFAARLNNMLSRREHL 203 Query: 189 ESFAAMFPAPRQRWVDGLASAEAAIRALPHETLVIHGREDQIIPLQTSLTLADWIARAQL 248 ++F A +++ D + IRA +TL++ GR D+ +P+ L L I ++L Sbjct: 204 DNFVKSLEANPKQFPD-FSPHLGEIRA---QTLIVWGRNDRFVPMDAGLRLLAGINGSEL 259 Query: 249 HVFGQCGHWTQIEHAARFASLVGDFLA 275 H++ CGHW Q EHA F LV DFLA Sbjct: 260 HIYRDCGHWAQWEHAESFNQLVLDFLA 286 Lambda K H 0.323 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 283 Length of database: 288 Length adjustment: 26 Effective length of query: 257 Effective length of database: 262 Effective search space: 67334 Effective search space used: 67334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory