Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate BWI76_RS05980 BWI76_RS05980 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ0 (294 letters) >FitnessBrowser__Koxy:BWI76_RS05980 Length = 260 Score = 210 bits (535), Expect = 2e-59 Identities = 122/260 (46%), Positives = 165/260 (63%), Gaps = 11/260 (4%) Query: 11 LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70 +L V+ +TM+FGGL A++ VSF + EI +IGPNGAGKTT+FN IT Y PT G +TL Sbjct: 7 ILEVQDVTMQFGGLRAIDSVSFHVDEAEIFGLIGPNGAGKTTMFNVITANYKPTSGSVTL 66 Query: 71 RHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSIA 130 K R+ A +ARTFQNIRLF M+VLEN++V L AS +S+ Sbjct: 67 AGKSLKGLKPNRVVN------AGIARTFQNIRLFNSMTVLENVMVG----LDSASRYSLL 116 Query: 131 -GLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVM 189 L + Y ER A A LD + + FAD +A NL YG QR++EIARA+ T P + Sbjct: 117 EAALHIGRYFPAERAAKAKAMAILDDIGIAHFADVQATNLSYGNQRKVEIARALATSPKL 176 Query: 190 LCLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKIS 249 L LDEPAAG+NP+E+ ELADL+ +R+++++ VLLIEHDM V + + V+VL+YG+ + Sbjct: 177 LLLDEPAAGMNPKETEELADLIFRMRNDYRLSVLLIEHDMPFVNKLCERVMVLEYGKPLF 236 Query: 250 DGDPAFVKNDPAVIRAYLGE 269 G + DP VI AYLG+ Sbjct: 237 SGLMSEAIQDPDVISAYLGD 256 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 189 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 260 Length adjustment: 25 Effective length of query: 269 Effective length of database: 235 Effective search space: 63215 Effective search space used: 63215 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory