Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate BWI76_RS12840 BWI76_RS12840 amino acid ABC transporter permease/ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >FitnessBrowser__Koxy:BWI76_RS12840 Length = 506 Score = 100 bits (250), Expect = 7e-26 Identities = 73/207 (35%), Positives = 112/207 (54%), Gaps = 12/207 (5%) Query: 155 WGGLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSS 214 W + L+L+ IV LG +LAL ++S +I +R +PL+ +L Sbjct: 22 WTVIKLSLLTWAFSIV----LGFILALAKQSPRKLFNAPARLYIWLFRSMPLLVLLIFVY 77 Query: 215 VM---LPLFLPEGMNFDKLLRALIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLGY 271 M LP F P +N D L+ ++L ++AYIAE+ RGGL +IPKGQ EAA A+GL Y Sbjct: 78 NMPQALPSFAPV-LN-DPFWAGLLAMVLSEAAYIAEIHRGGLLSIPKGQSEAARALGLRY 135 Query: 272 WRSMGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMAT 331 + V++PQAL++ +P + N +IA+ K +SLV +I L ++L V Q +L M T Sbjct: 136 AGTQWRVVIPQALRVALPALANEYIAIVKLSSLVSVISLTEIL-MVGQRLYSQNFLVMET 194 Query: 332 EGYV--FAALVFWIFCFGMSRYSMHLE 356 V + L+ +F F + R L+ Sbjct: 195 MAAVAFYYILIVTVFDFLLKRLETWLD 221 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 412 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 506 Length adjustment: 32 Effective length of query: 333 Effective length of database: 474 Effective search space: 157842 Effective search space used: 157842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory