Align D/L-lactic acid transporter; Lactate racemization operon protein LarD; Lactic acid channel (characterized)
to candidate BWI76_RS23100 BWI76_RS23100 aquaporin
Query= SwissProt::F9UST3 (238 letters) >FitnessBrowser__Koxy:BWI76_RS23100 Length = 266 Score = 100 bits (250), Expect = 2e-26 Identities = 80/254 (31%), Positives = 123/254 (48%), Gaps = 24/254 (9%) Query: 4 QLIAEFMGTALMIIFGVGVHCSSVLK-GTKYRGSGHIFAITTWGFGISVALFIFGNVC-- 60 Q AEF+GT L + FG+G C S LK G I I WG GIS+A+++ + Sbjct: 8 QCTAEFLGTGLFLFFGIG--CLSALKVAGASLGLWEICII--WGLGISLAVYLTSGISGG 63 Query: 61 -INPAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYADHFKA-------STDE 112 +NPA+ +A L PY V++V G G+V+ +++Y+ F + Sbjct: 64 HLNPAVTVALWLFACFPGRKVFPYIVSQVAGAFGGAVLAYVLYSTMFTEFESAHHIARGS 123 Query: 113 ISPITIRNLFCTAPAVR-NLPRNFFVELFDTFIFISGILAISE----IKTPGIVPIGVGL 167 + + + ++F T PA ++ VE+ T + + I+A+++ + + P+ +GL Sbjct: 124 VESLQLASIFSTYPAASLSIWHAALVEVVITSMLMGMIMALTDDGNGVPKGPLAPLLIGL 183 Query: 168 LVWAIGMGLGGPTGFAMNLARDMGPRIAHAIL---PIANKADSDWQYGIIVPGIAPFVGA 224 LV IG G TGFAMN ARD GP++ + IA D Y IVP IAP +GA Sbjct: 184 LVAVIGASTGPLTGFAMNPARDFGPKLFTWMAGWGDIAMTGGRDIPY-FIVPIIAPLIGA 242 Query: 225 AIAAWFMHGFFGIN 238 + A G N Sbjct: 243 CLGAAIYRYLIGNN 256 Lambda K H 0.330 0.145 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 266 Length adjustment: 24 Effective length of query: 214 Effective length of database: 242 Effective search space: 51788 Effective search space used: 51788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory