Align Glucosamine-6-phosphate deaminase; EC 3.5.99.6; GlcN6P deaminase; GNPDA; Glucosamine-6-phosphate isomerase (uncharacterized)
to candidate BWI76_RS00120 BWI76_RS00120 glucosamine-6-phosphate deaminase
Query= curated2:Q8ESL6 (250 letters) >FitnessBrowser__Koxy:BWI76_RS00120 Length = 245 Score = 134 bits (337), Expect = 2e-36 Identities = 82/245 (33%), Positives = 133/245 (54%), Gaps = 10/245 (4%) Query: 1 MKIIQTENYQSMSKLASQHVINTIKQLNKPVLGLATGSTPEGLYQHLIKAYRMHQISFAN 60 MK+I TE+Y MS +AS HV+ I + L + GSTP+ +Y+HL A + ++ Sbjct: 1 MKLIVTEDYAEMSLVASHHVLGYITAPRRMNLAVTAGSTPKKMYEHLTAAIKGKSF-YSQ 59 Query: 61 VSTFNLDEYVGLHKEDKNSYHYYMQKFLFNHVDIPYKNIHLPNGIAKDLSVECTSYEDRI 120 +N DE ++ + ++ F IP +NIH K ++ R+ Sbjct: 60 AHYYNFDEIPFRGQDREGVTISNLRSLFFTPAQIPEENIH------KLSHANFIHHDQRL 113 Query: 121 QQAGGIHIQVLGIGRNGHIGFNEPGTS-FESQTHVVDL--DESTRNANARFFDSIDEVPN 177 Q+ GG+ + V+G+G +GH N P T+ F T V + D A+ VP+ Sbjct: 114 QEEGGLDLVVMGLGADGHFCGNLPNTTRFHDATVKVPIVGDLVDLVAHGEMDGDFSAVPD 173 Query: 178 QAITMGIQSIMRAKEILLLVSGSEKAEALEKLVNGNVSEEFPASILQTHQNVKIIADKAA 237 +TMG +S+M AK +LL+VSG+ KA+AL++++ G VSE PAS+L+ H ++ I+ADKAA Sbjct: 174 SYVTMGPKSVMAAKNLLLIVSGAAKAQALKQVIEGEVSERVPASVLKLHPSLVIVADKAA 233 Query: 238 LQDIS 242 +++ Sbjct: 234 AAELT 238 Lambda K H 0.317 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 245 Length adjustment: 24 Effective length of query: 226 Effective length of database: 221 Effective search space: 49946 Effective search space used: 49946 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory