GapMind for catabolism of small carbon sources

 

Alignments for a candidate for ackA in Klebsiella michiganensis M5al

Align Probable propionate kinase; EC 2.7.2.15 (characterized)
to candidate BWI76_RS23200 BWI76_RS23200 propionate kinase

Query= SwissProt::P74879
         (404 letters)



>FitnessBrowser__Koxy:BWI76_RS23200
          Length = 404

 Score =  703 bits (1814), Expect = 0.0
 Identities = 350/404 (86%), Positives = 377/404 (93%)

Query: 1   MSYKIMAINAGSSSLKFQLLEMPQGDMLCQGLIERIGMADAQVTIKTHSQKWQETVPVAD 60
           MSYKIMAINAGSSSLKFQLLEMPQG+ LCQGLIERIGMA+AQVT+KT +QKWQE+ P+AD
Sbjct: 1   MSYKIMAINAGSSSLKFQLLEMPQGETLCQGLIERIGMANAQVTLKTPAQKWQESAPIAD 60

Query: 61  HRDAVTLLLEKLLGYQIINSLRDIDGVGHRVAHGGEFFKDSTLVTDETLAQIERLAELAP 120
           HR+AVTLLLEKLLGY+II SL+DIDGVGHRVAHGGE FKDST VTDE+LA+IERLAELAP
Sbjct: 61  HREAVTLLLEKLLGYRIIESLQDIDGVGHRVAHGGERFKDSTPVTDESLAEIERLAELAP 120

Query: 121 LHNPVNALGIHVFRQLLPDAPSVAVFDTAFHQTLDEPAYIYPLPWHYYAELGIRRYGFHG 180
           LHNPVNALGI VFRQLLPD PSVAVFDTAFHQTLDE A+IYPLPW YY+ELGIRRYGFHG
Sbjct: 121 LHNPVNALGIKVFRQLLPDTPSVAVFDTAFHQTLDERAFIYPLPWRYYSELGIRRYGFHG 180

Query: 181 TSHKYVSGVLAEKLGVPLSALRVICCHLGNGSSICAIKNGRSVNTSMGFTPQSGVMMGTR 240
           TSHKYVS  LAEKLGVPLSALRV+CCHLGNGSS+CAIK GRSVNTSMGFTPQSGVMMGTR
Sbjct: 181 TSHKYVSATLAEKLGVPLSALRVVCCHLGNGSSVCAIKGGRSVNTSMGFTPQSGVMMGTR 240

Query: 241 SGDIDPSILPWIAQRESKTPQQLNQLLNNESGLLGVSGVSSDYRDVEQAANTGNRQAKLA 300
           SGDIDPSILPW+A  E +TP+QLNQLLNNESGLLGVSGVS DYRDVEQAA+ GNR+A LA
Sbjct: 241 SGDIDPSILPWLALHEGQTPEQLNQLLNNESGLLGVSGVSHDYRDVEQAADGGNRRAALA 300

Query: 301 LTLFAERIRATIGSYIMQMGGLDALVFTGGIGENSARARSAVCHNLQFLGLAVDEEKNQR 360
           L LFAERIRATIGSYIMQMGG+DAL+FTGGIGENSARARSA+CHNL FLGL+VDEEKNQ 
Sbjct: 301 LALFAERIRATIGSYIMQMGGIDALIFTGGIGENSARARSAICHNLNFLGLSVDEEKNQH 360

Query: 361 NATFIQTENALVKVAVINTNEELMIAQDVMRIALPATEGLCVPA 404
           NATFIQ E+ALVKVAVINTNEELMIA+DVMR+ALPA E L V A
Sbjct: 361 NATFIQAEHALVKVAVINTNEELMIARDVMRLALPAAETLTVSA 404


Lambda     K      H
   0.319    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 630
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 404
Length of database: 404
Length adjustment: 31
Effective length of query: 373
Effective length of database: 373
Effective search space:   139129
Effective search space used:   139129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate BWI76_RS23200 BWI76_RS23200 (propionate kinase)
to HMM TIGR00016 (ackA: acetate kinase (EC 2.7.2.1))

Software error:

../bin/blast/fastacmd -i /tmp/list.31486.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.31486.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.