Align putative transporter, required for glycine and L-alanine utilization (characterized)
to candidate BWI76_RS05160 BWI76_RS05160 hypothetical protein
Query= reanno::ANA3:7023996 (213 letters) >FitnessBrowser__Koxy:BWI76_RS05160 Length = 207 Score = 141 bits (356), Expect = 8e-39 Identities = 81/203 (39%), Positives = 119/203 (58%), Gaps = 10/203 (4%) Query: 12 LIGILAEAMTGALAAGRKQMDLFGVVIIGCATAIGGGTLRDMLLGNYPLIWVENVHYLLA 71 +IG A++G L AG+ +MD FGV+++G TA+GGGT+RDM L N P+ WV++ L+ Sbjct: 8 IIGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGTIRDMALANGPVFWVKDPTDLVV 67 Query: 72 IAFASLLTVAIAPVMRYLSKLFL-AIDALGLAVFSIVGAQKTLMLGFSPTIAVVMGLVTG 130 S+ T+ + R L K L +DA+GLAVF +G K + P +AV MG+VTG Sbjct: 68 AMVTSMFTILLVRQPRRLPKWVLPVLDAVGLAVFVGIGVNKAFIAHSGPLVAVCMGVVTG 127 Query: 131 VFGGVIRDILCNQVPLIFKKELYA----VISLFTAGLYITLNA-YQLAEWINLVVCLTLG 185 V GG+IRD+L ++P+I + E+YA V + A Y T + A I +VV L Sbjct: 128 VGGGIIRDVLAREIPMILRTEIYATACIVGGIVHATAYYTFQVPLENAAMIGMVVTLV-- 185 Query: 186 FSLRMLALRYHWSMPTFDYQANG 208 +R+ A+R+H +PTF NG Sbjct: 186 --IRLAAIRWHLKLPTFALDENG 206 Score = 41.6 bits (96), Expect = 1e-08 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 7/86 (8%) Query: 96 IDALGLAVFSIVGAQKTLMLGFSPTIAVVMGLVTGVFGGVIRDILCNQVPLIFKKE---- 151 +D +G AVF+I G L P +V+G+VT V GG IRD+ P+ + K+ Sbjct: 6 LDIIGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGTIRDMALANGPVFWVKDPTDL 65 Query: 152 -LYAVISLFTAGLYITLNAYQLAEWI 176 + V S+FT + + +L +W+ Sbjct: 66 VVAMVTSMFT--ILLVRQPRRLPKWV 89 Lambda K H 0.330 0.143 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 10 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 213 Length of database: 207 Length adjustment: 21 Effective length of query: 192 Effective length of database: 186 Effective search space: 35712 Effective search space used: 35712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory