Align L-alanine and D-alanine permease (characterized)
to candidate BWI76_RS07360 BWI76_RS07360 phenylalanine transporter
Query= reanno::pseudo5_N2C3_1:AO356_17670 (473 letters) >FitnessBrowser__Koxy:BWI76_RS07360 Length = 458 Score = 412 bits (1059), Expect = e-119 Identities = 203/444 (45%), Positives = 287/444 (64%), Gaps = 3/444 (0%) Query: 15 GGPLKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGPAIMLSYIIGGLAILVIMRALG 74 G L R L RHI+L+ALG IG GLFLG AI+MAGPA++L Y + G+ +IMR LG Sbjct: 15 GPTLHRGLQNRHIQLIALGGAIGTGLFLGIGPAIQMAGPAVLLGYAVAGIVAFLIMRQLG 74 Query: 75 EMAVHNPVAGSFSRYAQDYLGPLAGFLTGWNYWFLWLVTCVAEITAVAVYMGIWFPDVPR 134 EM V PV+GSF+ +A Y GP AGFL+GWNYW ++++ +AE+TA +YM W PDVP Sbjct: 75 EMVVEEPVSGSFAHFAYKYWGPFAGFLSGWNYWVMFVLVGMAELTAAGIYMQYWLPDVPT 134 Query: 135 WIWALAALVSMGSINLIAVKAFGEFEFWFALIKIVTIIAMVIGGVGIIAFGFGNDGVALG 194 WIWA A + + ++NL+ V+ +GE EFWFALIK++ II M+ G G+ G+ G G Sbjct: 135 WIWAAAFFLIINAVNLVNVRLYGEAEFWFALIKVLAIIGMI--GFGLWMLFGGHGGSKAG 192 Query: 195 ISNLWAHGGFMPNGVSGVLMSLQMVMFAYLGVEMIGLTAGEAKNPQKTIPNAIGSVFWRI 254 I NLW HGGF G G++MSL ++MF++ G+E+IG+TA EA+NP+K+IP A+ V +RI Sbjct: 193 IDNLWKHGGFFATGWHGLIMSLAVIMFSFGGLELIGITAAEAQNPEKSIPKAVNQVVYRI 252 Query: 255 LLFYVGALFVILSIYPWNEIGTQGSPFVMTFERLGIKTAAGIINFVVITAALSSCNGGIF 314 LLFY+G+L V+L++YPW EI + SPFVM F L A +NFV++ A+LS N G++ Sbjct: 253 LLFYIGSLVVLLALYPWVEIQSDSSPFVMIFHNLDSNVVASALNFVILVASLSVYNSGVY 312 Query: 315 STGRMLYSLAQNGQAPAGFAKTSTNGVPRRALLLSIAALLLGVLLNYLVPEKVFVWVTSI 374 S RML+ L+ G AP A+ S GVP +LLLS L V+LNYL+P+K + ++ Sbjct: 313 SNSRMLFGLSVQGNAPKFLARVSKRGVPVNSLLLSGIITSLVVVLNYLLPQKALGLLMAL 372 Query: 375 ATFGAIWTWVMILLAQLKFRKSLSASERAALKYRMWLYPVSSYLALAFLVLVVGLMAYFP 434 + W+MI LA LKFR + R K++ L P S+Y+ +AFL L++ LM Sbjct: 373 VVATLLLNWIMICLAHLKFRAAQRRKGREP-KFKALLSPASNYICIAFLALILVLMCTID 431 Query: 435 DTRVALYVGPAFLVLLTVLFYTFK 458 R++ + P +++ L F T + Sbjct: 432 GMRLSAILLPVWILFLFAAFKTLR 455 Lambda K H 0.328 0.142 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 664 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 473 Length of database: 458 Length adjustment: 33 Effective length of query: 440 Effective length of database: 425 Effective search space: 187000 Effective search space used: 187000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory