Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate BWI76_RS16625 BWI76_RS16625 putative oxidoreductase
Query= reanno::HerbieS:HSERO_RS05210 (261 letters) >FitnessBrowser__Koxy:BWI76_RS16625 Length = 294 Score = 97.8 bits (242), Expect = 2e-25 Identities = 76/247 (30%), Positives = 118/247 (47%), Gaps = 6/247 (2%) Query: 16 LKGKRVFITGGGTGIGAAIVEAFAQQGAHVAFVDIATEASEA--LCNEVAAAGHPKPLFR 73 L GKR ITGG +GIG A+ AFA++GA VA + E S+A + + A G + + Sbjct: 47 LAGKRALITGGDSGIGRAVAIAFAREGADVAINYLPEEESDAQTVIALIEAEGR-QAVAI 105 Query: 74 HCDLRDIPAFQATIAELQAQLGDFDVLVNNAANDQR-HKLEEVTLEYWNDRIAINQRPSF 132 D+RD + + + ++LG D+LVNNA Q LEE+T ++ N +F Sbjct: 106 PGDVRDESFCETLVEQAASELGGLDILVNNAGRQQYCESLEELTTADFDATFKTNVYAAF 165 Query: 133 FAVQSVVEGMKRRGGGSIINFSSISWHQSGGGFPVYTTAKASTLGLTRGLARDLGPHKIR 192 + ++ + +K +IIN SS+ + Y KA + T+ LA+ LGP IR Sbjct: 166 WITKAALRHLKEH--SAIINTSSVQAFKPSPILLDYAQTKACLVAFTKSLAKQLGPKGIR 223 Query: 193 VNTVTPGWVMTERQIKLWLDEEGKKAIARNQCLQGDLLPWHLARMVLFLAADDSAMCTAQ 252 VN V PG T Q +E + + L P +A + + LA+D + + Q Sbjct: 224 VNAVAPGPYWTVLQSSGGQPDEKVRQFGADTPLGRPGQPVEIAPLYVTLASDACSFTSGQ 283 Query: 253 EFIVDAG 259 + D G Sbjct: 284 VWCSDGG 290 Lambda K H 0.321 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 294 Length adjustment: 25 Effective length of query: 236 Effective length of database: 269 Effective search space: 63484 Effective search space used: 63484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory