Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate BWI76_RS19640 BWI76_RS19640 galactose/methyl galactoside ABC transporter ATP-binding protein MglA
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__Koxy:BWI76_RS19640 Length = 506 Score = 162 bits (411), Expect = 1e-44 Identities = 82/241 (34%), Positives = 154/241 (63%), Gaps = 1/241 (0%) Query: 4 LLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVF 63 LLE+ +++KSF VKALD V++++ + AL+G+NGAGKSTL+K + G ++ D G ++F Sbjct: 13 LLEMTNINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGSILF 72 Query: 64 EGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKKMMEESKK 123 +G+++ F+S +A GI ++Q+L L+ + N++L R T +F+++ KM ++K Sbjct: 73 QGQEIDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLGRYPTKGVFVDQDKMYRDTKA 132 Query: 124 LLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVEARKVLEL 183 + D L I I D +V LS Q Q + +A+A ++AK+++MDEPT++L+ E + ++ Sbjct: 133 IFDELDIDI-DPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFKI 191 Query: 184 ARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEEITEVMTSFALG 243 R LK++G G++ I+H + + +++ D I +L G+ I + E ++++I +M +L Sbjct: 192 IRKLKERGCGIVYISHKMEEIFQLCDEITILRDGQWIATQPLEGLDMDKIIAMMVGRSLN 251 Query: 244 K 244 + Sbjct: 252 Q 252 Score = 92.8 bits (229), Expect = 1e-23 Identities = 53/217 (24%), Positives = 119/217 (54%), Gaps = 6/217 (2%) Query: 23 VSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVFEGKKVIFNSPNDARSLGIE 82 +S +++KGE++ + G GA ++ +++ + G + G + GKK+ +S N+A + G Sbjct: 282 ISFDLHKGEILGIAGLVGAKRTDIVETLFGIREKAGGTIRLHGKKINNHSANEAINHGFA 341 Query: 83 TIYQD---LALIPDLPIYYNIFLA--REVTNKI-FLNKKKMMEESKKLLDSLQIRIPDIN 136 + ++ + L I +N ++ ++ NK+ L+ +M +++ ++DS++++ P + Sbjct: 342 LVTEERRSTGIYAYLDIGFNSLISNIKKYKNKVGLLDNSRMKSDTQWVIDSMRVKTPGQH 401 Query: 137 MKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVEARKVLELARNLKKKGLGVLI 196 ++ +LSGG +Q V + R + +++++DEPT + V ++ +L L KK G++I Sbjct: 402 TQIGSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGIDVGAKFEIYQLIAELAKKDKGIII 461 Query: 197 ITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEEI 233 I+ + + + DRI V+ G + + + T EI Sbjct: 462 ISSEMPELLGITDRILVMSNGLVAGIVETKTTTQNEI 498 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 251 Length of database: 506 Length adjustment: 29 Effective length of query: 222 Effective length of database: 477 Effective search space: 105894 Effective search space used: 105894 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory