Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate BWI76_RS02995 BWI76_RS02995 aspartate carbamoyltransferase
Query= curated2:P18186 (319 letters) >FitnessBrowser__Koxy:BWI76_RS02995 Length = 311 Score = 136 bits (343), Expect = 6e-37 Identities = 106/316 (33%), Positives = 164/316 (51%), Gaps = 29/316 (9%) Query: 9 LYGKDLLTLKDLSEEDINALLAEAGELKQNKIQPIFHGKTLAMIFEKSSTRTRVSFEAGM 68 LY K ++++ DLS ED+ +LA A +LK + + K +A F ++STRTR+SFE M Sbjct: 5 LYQKHIISINDLSREDLELVLATAAKLKAHPQPELLKHKVIASCFFEASTRTRLSFETSM 64 Query: 69 AQLGGSAL-FLSQKDLQLG-RGETVADTAKVLSGYVDAIMIRTFEHEKVEELAKE--ADI 124 +LG S + F + LG +GET+ADT V+S YVDAI++R E LA E I Sbjct: 65 HRLGASVVGFSDSSNTSLGKKGETLADTISVISTYVDAIVMR-HPQEGAARLATEFSGGI 123 Query: 125 PVIN-GLTDKYHPCQALADLLTIKEIKGKLKGVKVAYIGD--GNNVAHSLMIGCAKMG-- 179 PV+N G HP Q L DL TI+E +G+L+ + VA +GD HSL AK Sbjct: 124 PVLNAGDGANQHPTQTLLDLFTIQETQGRLENLNVAMVGDLKYGRTVHSLTQALAKFNGN 183 Query: 180 -----CDISIASPKGYEVLDEAAEAAKTYALQSGSSVTLTDDPIEAVKDADVIYSDVFTS 234 ++A P+ +LD + ++L S E +++ D++Y + Sbjct: 184 RFYFIAPDALAMPQ--YILDMLDDKGIAWSLHSAIE--------EVMEEVDILY--MTRV 231 Query: 235 MGQEAEEQERLAVFAPYQVNAALVSHAKPDYTFLHCLPAHREEEVTAEIIDGPNSAVFQQ 294 + + E V A + + AA + A+ + LH LP R +E+T ++ P++ FQQ Sbjct: 232 QKERLDPSEYANVKAQFVLRAADLEGARANMKVLHPLP--RIDEITTDVDKTPHAWYFQQ 289 Query: 295 AENRLHVQKALLKAIL 310 A N + ++ALL +L Sbjct: 290 AGNGIFARQALLALVL 305 Lambda K H 0.315 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 311 Length adjustment: 27 Effective length of query: 292 Effective length of database: 284 Effective search space: 82928 Effective search space used: 82928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory