Align carbamate kinase (EC 2.7.2.2) (characterized)
to candidate BWI76_RS17520 BWI76_RS17520 carbamate kinase
Query= BRENDA::P0A2X7 (310 letters) >FitnessBrowser__Koxy:BWI76_RS17520 Length = 310 Score = 287 bits (734), Expect = 3e-82 Identities = 153/296 (51%), Positives = 204/296 (68%), Gaps = 7/296 (2%) Query: 1 MGKKMVVALGGNAILSNDASAHAQQQALVQTSAYLVHLIKQGHRLIVSHGNGPQVG--NL 58 M KK+V+ALGGNA L +D + Q QA+ T+ +V LI GH+++V+HGNGPQVG N Sbjct: 1 MSKKIVLALGGNA-LGDDLAG--QMQAVRHTARTIVDLIALGHQVVVTHGNGPQVGMINQ 57 Query: 59 LLQQQAADSEKNPAMPLDTCVAMTQGSIGYWLSNALNQELNKAGIKKQVATVLTQVVVDP 118 + A P +P+ CVA++QG IGY L NA+ +EL + VAT++TQV VD Sbjct: 58 AFEAAAKTEAHTPMLPMSVCVALSQGYIGYDLQNAIREELLSRQLDIPVATLITQVEVDA 117 Query: 119 ADEAFKNPTKPIGPFLTEAEAKEAMQAGAIFKEDAGRGWRKVVPSPKPIDIHEAETINTL 178 DEAF NPTKPIG F ++ EA++ Q G I KEDAGRG+R+VV SPKP+DI E +T+ L Sbjct: 118 NDEAFLNPTKPIGSFFSKEEAEKLSQNGYIMKEDAGRGYRRVVASPKPVDIIEKQTVKAL 177 Query: 179 IKNDIITISCGGGGIPVV--GQELKGVEAVIDKDFASEKLAELVDADALVILTGVDYVCI 236 + + + I+ GGGGIPV+ G L+G AVIDKD+AS KLAE +DAD L+ILT V+ V I Sbjct: 178 MDDCHVVITVGGGGIPVIREGNHLRGASAVIDKDWASAKLAETIDADLLIILTAVEKVAI 237 Query: 237 NYGKPDEKQLTNVTVAELEEYKQAGHFAPGSMLPKIEAAIQFVESQPNKQAIITSL 292 N+GKP E+ L N+++ + E + GHFA GSMLPK+EAA F S+P +QA+IT L Sbjct: 238 NFGKPGEQWLDNLSLRDAERFIAEGHFAKGSMLPKVEAAAAFARSRPGRQALITML 293 Lambda K H 0.313 0.131 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 310 Length adjustment: 27 Effective length of query: 283 Effective length of database: 283 Effective search space: 80089 Effective search space used: 80089 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS17520 BWI76_RS17520 (carbamate kinase)
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00746.hmm # target sequence database: /tmp/gapView.1100.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00746 [M=309] Accession: TIGR00746 Description: arcC: carbamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-117 377.6 1.0 2.2e-117 377.5 1.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS17520 BWI76_RS17520 carbamate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS17520 BWI76_RS17520 carbamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 377.5 1.0 2.2e-117 2.2e-117 1 308 [. 3 309 .. 3 310 .] 0.96 Alignments for each domain: == domain 1 score: 377.5 bits; conditional E-value: 2.2e-117 TIGR00746 1 kkvvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqvGalllqneaads.... 67 kk+v+aLGGnal + q+++v+++a+++v+l++ g+++v+thGngPqvG + eaa++ lcl|FitnessBrowser__Koxy:BWI76_RS17520 3 KKIVLALGGNALG-----DDLAGQMQAVRHTARTIVDLIALGHQVVVTHGNGPQVGMINQAFEAAAKteah 68 79**********8.....677899**********************************8777776665677 PP TIGR00746 68 vpakPldvlgaesqgliGYllqqalkeelakeglekkvatvltqvivdekDeaFqnPtkpigpfydeeeak 138 +p P+ v++a sqg iGY lq+a++eel ++l +vat++tqv+vd++DeaF nPtkpig f+++eea+ lcl|FitnessBrowser__Koxy:BWI76_RS17520 69 TPMLPMSVCVALSQGYIGYDLQNAIREELLSRQLDIPVATLITQVEVDANDEAFLNPTKPIGSFFSKEEAE 139 8889******************************************************************* PP TIGR00746 139 rlaaekgailkedagrgwRrvvpsPkPkeiveaeviktLvekgvivissgGGGvPvvkdgkelkGveaviD 209 +l ++g+i+kedagrg+Rrvv+sPkP++i+e +++k L+++ ++vi+ gGGG+Pv+++g++l+G aviD lcl|FitnessBrowser__Koxy:BWI76_RS17520 140 KL-SQNGYIMKEDAGRGYRRVVASPKPVDIIEKQTVKALMDDCHVVITVGGGGIPVIREGNHLRGASAVID 209 65.578***************************************************************** PP TIGR00746 210 kDlasekLaeevnaDilviltdvdavyvnygkpdekkleevkveeleelakdgefaaGsmgPkveaaiefv 280 kD as+kLae+++aD l+ilt+v++v++n+gkp e++l ++++ ++e+++++g+fa+Gsm+Pkveaa f+ lcl|FitnessBrowser__Koxy:BWI76_RS17520 210 KDWASAKLAETIDADLLIILTAVEKVAINFGKPGEQWLDNLSLRDAERFIAEGHFAKGSMLPKVEAAAAFA 280 *********************************************************************** PP TIGR00746 281 esrgk.kaiitslekivealegkaGtvvv 308 +sr+ +a+it l+k++e +egk+Gt+++ lcl|FitnessBrowser__Koxy:BWI76_RS17520 281 RSRPGrQALITMLSKAKEGIEGKTGTIIS 309 **9877*********************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (310 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.19 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory