Align histidine ABC transporter, periplasmic histidine-binding protein HisJ (characterized)
to candidate BWI76_RS07345 BWI76_RS07345 family 3 extracellular solute-binding protein
Query= CharProtDB::CH_014295 (260 letters) >FitnessBrowser__Koxy:BWI76_RS07345 Length = 258 Score = 267 bits (683), Expect = 1e-76 Identities = 135/260 (51%), Positives = 178/260 (68%), Gaps = 3/260 (1%) Query: 1 MKKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELC 60 MKK SL L +A ++T+A A + IR G DPT+APFE K+ QG+L GFDIDL +C Sbjct: 1 MKK---SLLLWVALMASTSALAVENKEIRFGVDPTFAPFEWKDPQGKLAGFDIDLGNAIC 57 Query: 61 KRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAK 120 ++ +C +VE+ D +IP+LKA+K DAI+S + +TEKR+++I F+DKLY LV K Sbjct: 58 AQLQAKCVWVESNFDGIIPALKARKFDAILSGMYMTEKRKEQIGFSDKLYNGPVFLVARK 117 Query: 121 NSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAA 180 N+ TVE LKGK +GV QG+ QET+ N+HW GI IV+YQG D + DL +GRID A Sbjct: 118 NTLAGNTVEQLKGKTIGVEQGSAQETYVNQHWRTAGINIVAYQGADRVVQDLESGRIDGA 177 Query: 181 FQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMR 240 + A FL+QP GKD+ F G +KD+KLFG G +GLRKED+ LR+ +N A A + Sbjct: 178 VLSGMMADYSFLQQPQGKDFAFVGGHLKDDKLFGAGAAIGLRKEDDALRQEINGAIARIL 237 Query: 241 ADGTYEKLAKKYFDFDVYGG 260 ADGTY+KLA KYF FDVY G Sbjct: 238 ADGTYKKLAGKYFSFDVYSG 257 Lambda K H 0.315 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 258 Length adjustment: 24 Effective length of query: 236 Effective length of database: 234 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory