Align L-Arginine ABC transporter, permease protein AotM (characterized)
to candidate BWI76_RS07585 BWI76_RS07585 polar amino acid ABC transporter inner membrane subunit
Query= reanno::pseudo6_N2E2:Pf6N2E2_5662 (232 letters) >FitnessBrowser__Koxy:BWI76_RS07585 Length = 221 Score = 129 bits (325), Expect = 4e-35 Identities = 76/211 (36%), Positives = 115/211 (54%), Gaps = 9/211 (4%) Query: 7 VIYEALPLYFSGLLTTLKLLALSLFFGLLAALPLGLMRVSKQPIVNMTAWLYTYVIRGTP 66 VI+ + +GLL TL+L + GL+ + L + ++ +N + ++R P Sbjct: 6 VIWSVRDSFIAGLLATLELFITAAIAGLIIGVVLCYLTEYQKKTLNRLIIAFVSLMRAIP 65 Query: 67 MLVQLFLIYYGLAQFAIVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRATSNG 126 L+ +L+YYGL Q I E PW + +A I AY EI+ R S G Sbjct: 66 FLILAYLLYYGLPQVGISME----PWTAGL-----IALVIYHGAYFFEILRSQRRVFSGG 116 Query: 127 EIEAAKAMGMSRYKLYRRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITGAART 186 IEAA A G SRYK++RRI+LP+ L ALP N++I+ L+ T+ SI+T+ +IT AA + Sbjct: 117 YIEAAVAQGFSRYKIFRRIILPNILSSALPLMGNQLIICLKDTAFLSIITVQEITAAANS 176 Query: 187 VNAQYYLPFEAYITAGVFYLCLTFILVRLFK 217 V A Y++PF A+I A Y ++ +L L K Sbjct: 177 VQATYFIPFNAFIVAIGLYWAISILLELLIK 207 Lambda K H 0.330 0.140 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 114 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 221 Length adjustment: 22 Effective length of query: 210 Effective length of database: 199 Effective search space: 41790 Effective search space used: 41790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory