Align Succinylglutamate desuccinylase; EC 3.5.1.96 (characterized)
to candidate BWI76_RS11690 BWI76_RS11690 succinylglutamate desuccinylase
Query= SwissProt::Q8ZPU8 (322 letters) >FitnessBrowser__Koxy:BWI76_RS11690 Length = 321 Score = 415 bits (1066), Expect = e-121 Identities = 209/320 (65%), Positives = 243/320 (75%), Gaps = 1/320 (0%) Query: 1 MDNFLALTLSGTTPRVTQGKGAGFRWRWLGHGLLELTPDAPVDRALILSAGIHGNETAPV 60 MD+FLALTL+G P G+ A FRW W+ G+L+L P P DR+L+LS+G+HGNETAPV Sbjct: 1 MDDFLALTLAGRLPHHFHGQTAQFRWHWIDCGILQLVPHEPCDRSLVLSSGLHGNETAPV 60 Query: 61 EMLDKLLSALYSGSLTLTWRVLVVLGNPQALAAGIRYCHSDMNRMFGGRWQSFAESDETR 120 E+ D LL L+ G L WR+LV+ GNPQAL A RY HSD+NRMFG RW++F+ SDET Sbjct: 61 EITDLLLRQLFRGETPLRWRLLVIFGNPQALRANKRYLHSDINRMFGERWRAFSASDETV 120 Query: 121 RARELELSLETFFSSGQARVRWHLDLHTAIRGSHHLRFGVLPQRDRPWETDFLAWLGAAG 180 RAR+LE +L F+++ A RWHLDLHTAIRGS H RFGVLP R++PW+ FL WLGAAG Sbjct: 121 RARQLEHALARFYAA-TAGERWHLDLHTAIRGSLHTRFGVLPAREKPWDEGFLRWLGAAG 179 Query: 181 LEALVFHQAPGGTFTHFSSEHFGALSCTLELGKALPFRQNDLTQFNVTSQALSALLSGVE 240 LEALVFHQ PGGTFTHFSSE FGALSCTLELGKALPF NDL F T +ALS LL+G Sbjct: 180 LEALVFHQQPGGTFTHFSSERFGALSCTLELGKALPFGDNDLRLFAATQRALSLLLAGEL 239 Query: 241 TSTSFSPPLRYRVVSQITRHSDKFALYMDAQTLNFTAFAKGTLLAEEGDKRVTVTHDVEY 300 T PLRYRVV QITR SD+F L+M AQTLNFT F+ GTLLAE+GD R V + EY Sbjct: 240 TLEDEHTPLRYRVVQQITRSSDRFQLHMSAQTLNFTLFSFGTLLAEDGDTRYVVEGEQEY 299 Query: 301 VLFPNPSVACGLRAGLMLER 320 VLFPNPSVA G RAGLML+R Sbjct: 300 VLFPNPSVAFGQRAGLMLQR 319 Lambda K H 0.322 0.136 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 322 Length of database: 321 Length adjustment: 28 Effective length of query: 294 Effective length of database: 293 Effective search space: 86142 Effective search space used: 86142 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS11690 BWI76_RS11690 (succinylglutamate desuccinylase)
to HMM TIGR03242 (astE: succinylglutamate desuccinylase (EC 3.5.1.96))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03242.hmm # target sequence database: /tmp/gapView.26968.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03242 [M=319] Accession: TIGR03242 Description: arg_catab_astE: succinylglutamate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-131 424.5 0.0 1.6e-131 424.3 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS11690 BWI76_RS11690 succinylglutamate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS11690 BWI76_RS11690 succinylglutamate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 424.3 0.0 1.6e-131 1.6e-131 1 319 [] 3 318 .. 3 318 .. 0.99 Alignments for each domain: == domain 1 score: 424.3 bits; conditional E-value: 1.6e-131 TIGR03242 1 dflaltlekkepevtqgeaknvklrwldeGvlelePeaeaekslvisaGihGnetaPielleqllsdiaag 71 dflaltl+ + p+ +g++ +++++w+d G+l+l+P++ +++slv+s+G+hGnetaP+e+ + ll+++++g lcl|FitnessBrowser__Koxy:BWI76_RS11690 3 DFLALTLAGRLPHHFHGQTAQFRWHWIDCGILQLVPHEPCDRSLVLSSGLHGNETAPVEITDLLLRQLFRG 73 8********************************************************************** PP TIGR03242 72 klqlkvrlLlilGnpaalrkgkRyleedlnRlfgGryqeleeskeklRaeeLeqvveaffeagkasearyh 142 + +l++rlL+i+Gnp+alr++kRyl++d+nR+fg r++ +++s+e+ Ra++Le+++++f++a+ r+h lcl|FitnessBrowser__Koxy:BWI76_RS11690 74 ETPLRWRLLVIFGNPQALRANKRYLHSDINRMFGERWRAFSASDETVRARQLEHALARFYAATAGE--RWH 142 ************************************************************987665..9** PP TIGR03242 143 yDlhtaiRasklekfallPyqekpfdkellewlaaadldavllhkekggtfshfssekleaeactlelGka 213 +DlhtaiR+s++ +f++lP++ekp+d+ +l+wl+aa+l+a+++h+++ggtf+hfsse+++a +ctlelGka lcl|FitnessBrowser__Koxy:BWI76_RS11690 143 LDLHTAIRGSLHTRFGVLPAREKPWDEGFLRWLGAAGLEALVFHQQPGGTFTHFSSERFGALSCTLELGKA 213 *********************************************************************** PP TIGR03242 214 rPfGendlsqfqaitealralisdeaiparkkeelklfevvesilkksdsfelhvaedasnftefakGtll 284 +PfG+ndl+ f+a+++al+ l+++e + ++++++l+ ++vv++i+++sd f+lh+++++ nft f+ Gtll lcl|FitnessBrowser__Koxy:BWI76_RS11690 214 LPFGDNDLRLFAATQRALSLLLAGELTLEDEHTPLR-YRVVQQITRSSDRFQLHMSAQTLNFTLFSFGTLL 283 ***********************************9.********************************** PP TIGR03242 285 aedkderyrveeeeerilfPnakvanGlRaglllv 319 aed d+ry+ve e+e++lfPn++va G+Ragl+l+ lcl|FitnessBrowser__Koxy:BWI76_RS11690 284 AEDGDTRYVVEGEQEYVLFPNPSVAFGQRAGLMLQ 318 *********************************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (319 nodes) Target sequences: 1 (321 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.21 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory