Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate BWI76_RS07275 BWI76_RS07275 ABC transporter
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__Koxy:BWI76_RS07275 Length = 368 Score = 254 bits (649), Expect = 3e-72 Identities = 156/364 (42%), Positives = 216/364 (59%), Gaps = 42/364 (11%) Query: 108 LKIALIALLLYPMVVVAIKGPQGSLTYVDNFGIQI----LIYVMLAWGLNIVVGLAGLLD 163 + + + ALL+ PMV + G N+ +++ L+YVMLA GLNIVVG GLLD Sbjct: 19 MTLLVCALLVAPMVASQLGG---------NYWVRVIDFALLYVMLALGLNIVVGYTGLLD 69 Query: 164 LGYVAFYAVGAYSYALLSSYFGL----------------SFWVLLPLSGIFAALWGVILG 207 +G++AFYAVGAY ALL+S L S+ V++PL+ + AA G++LG Sbjct: 70 MGFIAFYAVGAYLAALLASPHLLDVFPILNSWFPDGLHTSWLVIIPLAALVAAGCGIVLG 129 Query: 208 FPVLRLRGDYLAIVTLAFGEIIRLVLINW---TDVTKGTFGISSIPKATLFGIPFDATAG 264 P L+LRGDYLAIVTL FGEIIR+++ N ++T G GIS + LFG+ F Sbjct: 130 APTLKLRGDYLAIVTLGFGEIIRILMRNLDRPVNITNGAKGISGVDSLNLFGLKFSGVYH 189 Query: 265 GFAKLFHLPISSAYYKIFLFYLILALCMLTAYVTIRLRRMPIGRAWEALREDEIACRSLG 324 F F +P +Y YL++ + + +V +RL+ IGRAW A+REDE R++G Sbjct: 190 WFG--FKVPALWLWY-----YLLMLVIVAIIFVCLRLQHSRIGRAWHAIREDEDVARAMG 242 Query: 325 INTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVILAIVVLGGMGSLTGI 384 IN KL AFA GA F G AG+ F A QGFVSPESF ES +LA+VVLGGMG + G+ Sbjct: 243 INLRNYKLLAFAIGASFGGVAGALFGAFQGFVSPESFTLQESIAVLAMVVLGGMGHIPGV 302 Query: 385 AIAAIVMVGGTELLREMS--FLKLIFGPD-FTPELYRMLIFGLAMVVVMLFKPRGFVGSR 441 + A+++ ELLR + + +FG PE+ R L +GLA+V+VML +P+G +R Sbjct: 303 ILGAVLLTALPELLRSQAAPVQQALFGEVLIDPEVLRQLFYGLALVLVMLLRPQGIWPAR 362 Query: 442 EPTA 445 A Sbjct: 363 HQGA 366 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 487 Number of extensions: 37 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 368 Length adjustment: 31 Effective length of query: 432 Effective length of database: 337 Effective search space: 145584 Effective search space used: 145584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory