Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate BWI76_RS26340 BWI76_RS26340 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__Koxy:BWI76_RS26340 Length = 426 Score = 323 bits (829), Expect = 5e-93 Identities = 197/441 (44%), Positives = 271/441 (61%), Gaps = 34/441 (7%) Query: 23 ALFAAVLSFGMFVLYVGLKTDQNISNELIIVQ---RWGLLAIFVAVAAIGRFAMVVFIRP 79 AL +AV+ F + +++G++ + + + ++ RW + I AV + VF + Sbjct: 9 ALLSAVMFFILAGVFMGVQLELDGTKLVVDTAADIRWQWIYIGTAVVFFFQLLRPVF-QK 67 Query: 80 NIDRRKLSKAREGELDISTEKSFFHRHFLKIALIALLLYPMVVVAIKGPQGSLTYVDNFG 139 I K +D ST K K+ LIALL V+A+ P + Sbjct: 68 TIKNVSGPKFILPAIDGSTVKQ-------KLFLIALL-----VIAVAWPFMVSRGTVDIA 115 Query: 140 IQILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLSSYFGLSFWVLLPLSGIFA 199 +IY++L GLN+VVGL+GLL LGY FYA+GAY++ALL+ Y+GL FW LPL+G+ + Sbjct: 116 TLTMIYIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTFALLNHYYGLGFWTCLPLAGLVS 175 Query: 200 ALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLINWTDVTKGTFGISSIPKATLFGIPF 259 A G +LGFPVLRLRGDYLAIVTL FGEI+R++L+N T++T G GIS IPK TLFG+ F Sbjct: 176 AAAGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGISQIPKPTLFGLEF 235 Query: 260 DATA--GG---FAKLFHLPISSAYYKIFLFYLILALCMLTAYVTIRLRRMPIGRAWEALR 314 +A GG F+ F + + IFL+ + L L +L+ +V RL RMP+GRAWEALR Sbjct: 236 SRSAREGGWDTFSNFFGVKYDPSDRVIFLYLVALLLVVLSLFVINRLLRMPLGRAWEALR 295 Query: 315 EDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVILAIVV 374 EDEIACRSLG++ KLTAF A FAGFAG+ FAARQGFVSPESF F ESA +LAIVV Sbjct: 296 EDEIACRSLGLSPTRIKLTAFTISAAFAGFAGTLFAARQGFVSPESFTFAESAFVLAIVV 355 Query: 375 LGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGPDFTPELYRMLIFGLAMVVVMLFKP 434 LGGMGS + +AA+++V EL+R+ + Y ML+ G MV++M+++P Sbjct: 356 LGGMGSQFAVILAAVLLVVSRELMRDFN-------------EYSMLMLGALMVLMMIWRP 402 Query: 435 RGFVGSREPTAFLRERKAISG 455 +G + P L+ +A G Sbjct: 403 QGLLPMTRPQLKLKNGQAKEG 423 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 561 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 426 Length adjustment: 32 Effective length of query: 431 Effective length of database: 394 Effective search space: 169814 Effective search space used: 169814 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory