Align guanidinobutyrase subunit (EC 3.5.3.7) (characterized)
to candidate BWI76_RS21925 BWI76_RS21925 agmatinase
Query= metacyc::MONOMER-11557 (320 letters) >FitnessBrowser__Koxy:BWI76_RS21925 Length = 323 Score = 294 bits (753), Expect = 2e-84 Identities = 150/315 (47%), Positives = 202/315 (64%), Gaps = 3/315 (0%) Query: 1 MRPTVDKTLHQPLGGNEMPRFGGIATMLRLPHLQSAKGLDAAFIGVPLDIGTSLRSGTRF 60 M +K QP G E+PRF G+ T RLP A LD +GVP D GT+ R+GTR Sbjct: 1 MTTATEKNYPQPQDG-EIPRFSGLPTFFRLPFAPQAAELDIGIVGVPWDGGTTNRAGTRH 59 Query: 61 GPRQIRAESVMIRPYNMATGAAPFDSLSVADIGDVAINTFNLLDAVRIIEEAYDEIVEHN 120 GPR++R S ++R + T +P+D V D+GDV IN ++ D++ IE Y + E Sbjct: 60 GPRELRNASSLVRRIHQTTRRSPYDYARVGDLGDVRINPVDMQDSLARIEAWYRALAEQQ 119 Query: 121 VIPMTLGGDHTITLPILRALHKKHGKIGLVHIDAHADVNDHMFG-EKIAHGTTFRRAVEE 179 V+P+T GGDH TLPILRAL + +G++H DAH+D ND FG E+ HGT FRRAVEE Sbjct: 120 VMPLTAGGDHLTTLPILRALGRDK-PLGMIHFDAHSDTNDSYFGGERFTHGTPFRRAVEE 178 Query: 180 GLLDCDRVVQIGLRAQGYTADDFNWSRRQGFRVVQAEECWHKSLEPLMAEVREKVGGGPV 239 G+LD R VQIG+R ++AD+ W+ G +++ E+ ++ +M R VG P Sbjct: 179 GVLDPRRTVQIGIRGALFSADEHCWAEENGITIIRMEQVDELGIDKVMQRARAIVGEQPT 238 Query: 240 YLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCHGLDLIGCDLVEVSPPYDTTGNT 299 Y+SFDID +DP +APGTGTPEIGG+TT+QA +R GL+LIG D+VEVSPP+D T Sbjct: 239 YISFDIDVLDPVYAPGTGTPEIGGMTTLQAQRCVRQLAGLNLIGADVVEVSPPFDQGNLT 298 Query: 300 SLLGANLLFEMLCVL 314 SL GA ++FE+LC L Sbjct: 299 SLTGATMMFELLCQL 313 Lambda K H 0.322 0.141 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 377 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 323 Length adjustment: 28 Effective length of query: 292 Effective length of database: 295 Effective search space: 86140 Effective search space used: 86140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory