GapMind for catabolism of small carbon sources

 

Aligments for a candidate for kauB in Klebsiella michiganensis M5al

Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate BWI76_RS03865 BWI76_RS03865 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase

Query= metacyc::MONOMER-11560
         (497 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS03865 BWI76_RS03865
           5-carboxymethyl-2-hydroxymuconate semialdehyde
           dehydrogenase
          Length = 488

 Score =  350 bits (898), Expect = e-101
 Identities = 199/481 (41%), Positives = 277/481 (57%), Gaps = 15/481 (3%)

Query: 23  FINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAPAK 82
           +ING+  +    + F   +P  G  LA+VAS    + N+AV  A+  F    W+ L P K
Sbjct: 7   WINGK--NVAGSDYFHTTNPATGEVLAEVASGGADEVNQAVAAAKEAFPK--WANL-PMK 61

Query: 83  RKAKLIR-FADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYDE 141
            +A+L+R   DL+ +NV E+A +ET D G PI  + ++ IP A+    + AE   ++  +
Sbjct: 62  ERARLMRRLGDLIDQNVPEIAAMETADTGLPIHQTKNVLIPRASHNFEFFAEVCQQMNGK 121

Query: 142 VAPTPHDQLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPLTAI 201
             P     L     +PVGV   + PWN P + A WK+ P LA GN+ VLK SE SPLTA 
Sbjct: 122 TYPVDDKMLNYTLVQPVGVCALVSPWNVPFMTATWKVAPCLALGNTAVLKMSELSPLTAD 181

Query: 202 RIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGESNM 261
           R+ +LA+EAGIPAGVLNV+ GYG T G AL  H DV  + FTG T   + +M  AG   +
Sbjct: 182 RLGELALEAGIPAGVLNVVQGYGATAGDALVRHHDVRAVSFTGGTATGRNIMKNAG---L 238

Query: 262 KRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFLPM 321
           K+  +E GGKSP ++F DA D++ A +AA   I    GE CTAGSR+ +++SI  +F+  
Sbjct: 239 KKYSMELGGKSPVLIFEDA-DIERALDAALFTIFSINGERCTAGSRIFIQQSIYPEFVKR 297

Query: 322 VVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTLEE---- 377
             E     + G+P DP T VGAL+  Q    V  YI  G ++GA LLAGG     +    
Sbjct: 298 FAERANRLRVGDPTDPNTQVGALISQQHWEKVSGYIRLGIEEGATLLAGGADKPTDLPAH 357

Query: 378 -TGGTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWTS 436
              G ++ PT+   V N MR+AQEEIFGPV  ++ F    E + +AND  YGLA+ IWT 
Sbjct: 358 LRNGNFLRPTVLADVDNRMRVAQEEIFGPVACLLPFKDEAEGLRLANDVEYGLASYIWTQ 417

Query: 437 DISKAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELKATWIK 496
           D+SK  + AR + AG V+VN  +  D+  PFGG K SG GR+   ++ E + E+K   I 
Sbjct: 418 DVSKVLRLARGIEAGMVFVNTQNVRDLRQPFGGVKASGTGREGGEYSFEVFAEMKNVCIS 477

Query: 497 L 497
           +
Sbjct: 478 M 478


Lambda     K      H
   0.316    0.132    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 623
Number of extensions: 33
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 497
Length of database: 488
Length adjustment: 34
Effective length of query: 463
Effective length of database: 454
Effective search space:   210202
Effective search space used:   210202
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory